Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KD Validated] ATG7 Rabbit mAb (A19604)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KD Validated] ATG7 Rabbit mAb (A19604)

Western blot analysis of various lysates using [KD Validated] ATG7 Rabbit mAb (A19604) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KD Validated] ATG7 Rabbit mAb (A19604)

Western blot analysis of lysates from wild type(WT) and ATG7 knockout (KD) HeLa cells, using ATG7 antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: ARC0083.

ABclonal:Immunohistochemistry - [KD Validated] ATG7 Rabbit mAb (A19604)

Immunohistochemistry analysis of ATG7 in paraffin-embedded rat spleen using [KD Validated] ATG7 Rabbit mAb (A19604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KD Validated] ATG7 Rabbit mAb (A19604)

Immunohistochemistry analysis of ATG7 in paraffin-embedded human esophageal cancer using [KD Validated] ATG7 Rabbit mAb (A19604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name [KD Validated] ATG7 Rabbit mAb
Catalog No. A19604
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0083

Background

This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associated with multiple functions, including axon membrane trafficking, axonal homeostasis, mitophagy, adipose differentiation, and hematopoietic stem cell maintenance. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352).
Sequence MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
Gene ID 10533
Swiss prot O95352
Synonyms GSA7; [KD Validated] ATG7
Calculated MW 78kDa
Observed MW 77kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples HeLa, THP-1, 293T, Mouse brain, Mouse lung, Mouse spleen, Rat testis
Cellular location Cytoplasm, Preautophagosomal structure
Customer validation

IP (Homo sapiens)

WB (Mus musculus, Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] ATG7 Rabbit mAb images

ABclonal:Western blot - [KD Validated] ATG7 Rabbit mAb (A19604)}

Western blot - [KD Validated] ATG7 Rabbit mAb (A19604)

Western blot analysis of various lysates using [KD Validated] ATG7 Rabbit mAb (A19604) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KD Validated] ATG7 Rabbit mAb (A19604)}

Western blot - [KD Validated] ATG7 Rabbit mAb (A19604)

Western blot analysis of lysates from wild type(WT) and ATG7 knockout (KD) HeLa cells, using ATG7 antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: ARC0083.
ABclonal:Immunohistochemistry - [KD Validated] ATG7 Rabbit mAb (A19604)}

Immunohistochemistry - [KD Validated] ATG7 Rabbit mAb (A19604)

Immunohistochemistry analysis of ATG7 in paraffin-embedded rat spleen using [KD Validated] ATG7 Rabbit mAb (A19604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KD Validated] ATG7 Rabbit mAb (A19604)}

Immunohistochemistry - [KD Validated] ATG7 Rabbit mAb (A19604)

Immunohistochemistry analysis of ATG7 in paraffin-embedded human esophageal cancer using [KD Validated] ATG7 Rabbit mAb (A19604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19604 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ATG7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ATG7. (Distance between topics and target gene indicate popularity.) ATG7

* Data provided by citexs.com, for reference only.

Publishing research using A19604? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order