Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ARMC6 Rabbit pAb (A15931)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ARMC6 Rabbit pAb (A15931)

Western blot analysis of various lysates using ARMC6 Rabbit pAb (A15931) at 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - ARMC6 Rabbit pAb (A15931)

Immunofluorescence analysis of L929 cells using ARMC6 Rabbit pAb (A15931) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ARMC6 Rabbit pAb
Catalog No. A15931
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The function of this gene's protein product has not been determined. A related protein in mouse suggests that this protein has a conserved function. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ARMC6 (NP_001186125.1).
Sequence MSERCCSRYSSGASIGCTPTSTQAKMVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVEQFESQGVDLSNIVKTAPKVSADGSQEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVLTDGQPDLLDAQGLQLLVATLTQNADEADLTCSGIRCVRHACLKHEQNRQDLVKAG
Gene ID 93436
Swiss prot Q6NXE6
Synonyms R30923_1; ARMC6
Calculated MW 54kDa
Observed MW 54kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples A-431, 293T, LO2, Mouse brain, Mouse liver, Mouse pancreas, Rat testis, Rat brain
Cellular location cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ARMC6 Rabbit pAb images

ABclonal:Western blot - ARMC6 Rabbit pAb (A15931)}

Western blot - ARMC6 Rabbit pAb (A15931)

Western blot analysis of various lysates using ARMC6 Rabbit pAb (A15931) at 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - ARMC6 Rabbit pAb (A15931)}

Immunofluorescence - ARMC6 Rabbit pAb (A15931)

Immunofluorescence analysis of L929 cells using ARMC6 Rabbit pAb (A15931) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15931 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ARMC6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ARMC6. (Distance between topics and target gene indicate popularity.) ARMC6

* Data provided by citexs.com, for reference only.

Publishing research using A15931? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order