Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ARL8B Rabbit pAb (A8869)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ARL8B Rabbit pAb (A8869)

Western blot analysis of various lysates using ARL8B Rabbit pAb (A8869) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunofluorescence - ARL8B Rabbit pAb (A8869)

Confocal immunofluorescence analysis of U2OS cells using ARL8B Rabbit pAb (A8869) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ARL8B Rabbit pAb
Catalog No. A8869
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables guanyl ribonucleotide binding activity and tubulin binding activity. Involved in several processes, including calcium ion regulated lysosome exocytosis; lysosomal transport; and vesicle fusion. Located in cytolytic granule membrane; midbody; and spindle midzone. Colocalizes with lysosomal membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 127-186 of human ARL8B (NP_060654.1).
Sequence VLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Gene ID 55207
Swiss prot Q9NVJ2
Synonyms Gie1; ARL10C; ARL8B
Calculated MW 22kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:3000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples U-87MG, LO2, Mouse brain, Mouse heart, Mouse kidney
Cellular location Cytoplasm, Late endosome membrane, Lysosome membrane, cytoskeleton, spindle

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ARL8B Rabbit pAb images

ABclonal:Western blot - ARL8B Rabbit pAb (A8869)}

Western blot - ARL8B Rabbit pAb (A8869)

Western blot analysis of various lysates using ARL8B Rabbit pAb (A8869) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
ABclonal:Immunofluorescence - ARL8B Rabbit pAb (A8869)}

Immunofluorescence - ARL8B Rabbit pAb (A8869)

Confocal immunofluorescence analysis of U2OS cells using ARL8B Rabbit pAb (A8869) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A8869 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ARL8B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ARL8B. (Distance between topics and target gene indicate popularity.) ARL8B

* Data provided by citexs.com, for reference only.

Publishing research using A8869? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order