Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

APOA1 Rabbit pAb (A1129)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - APOA1 Rabbit pAb (A1129)

Western blot analysis of various lysates, using APOA1 Rabbit pAb (A1129) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HAP1
Exposure time: 180s.

ABclonal:Immunohistochemistry - APOA1 Rabbit pAb (A1129)

Immunohistochemistry analysis of APOA1 in paraffin-embedded mouse liver using APOA1 Rabbit pAb (A1129) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - APOA1 Rabbit pAb (A1129)

Immunofluorescence analysis of HepG2 cells using APOA1 Rabbit pAb (A1129) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name APOA1 Rabbit pAb
Catalog No. A1129
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 25-267 of human APOA1 (NP_000030.1).
Sequence DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Gene ID 335
Swiss prot P02647
Synonyms HPALP2; apo(a); APOA1
Calculated MW 28kDa
Observed MW 29kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Hep G2, Mouse plasma, Mouse liver, Rat liver, Rat plasma
Cellular location Secreted
Customer validation

WB (Mus musculus, Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

APOA1 Rabbit pAb images

ABclonal:Western blot - APOA1 Rabbit pAb (A1129)}

Western blot - APOA1 Rabbit pAb (A1129)

Western blot analysis of various lysates, using APOA1 Rabbit pAb (A1129) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HAP1
Exposure time: 180s.
ABclonal:Immunohistochemistry - APOA1 Rabbit pAb (A1129)}

Immunohistochemistry - APOA1 Rabbit pAb (A1129)

Immunohistochemistry analysis of APOA1 in paraffin-embedded mouse liver using APOA1 Rabbit pAb (A1129) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - APOA1 Rabbit pAb (A1129)}

Immunofluorescence - APOA1 Rabbit pAb (A1129)

Immunofluorescence analysis of HepG2 cells using APOA1 Rabbit pAb (A1129) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1129 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on APOA1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to APOA1. (Distance between topics and target gene indicate popularity.) APOA1

* Data provided by citexs.com, for reference only.

Publishing research using A1129? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order