Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Annexin A6/Annexin VI Rabbit pAb (A5390)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Annexin A6/Annexin VI Rabbit pAb (A5390)

Western blot analysis of various lysates, using Annexin A6/Annexin VI Rabbit pAb (A5390) at 1:6000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name Annexin A6/Annexin VI Rabbit pAb
Catalog No. A5390
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Annexin A6/Annexin VI (NP_001146.2).
Sequence MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIR
Gene ID 309
Swiss prot P08133
Synonyms p68; p70; ANX6; CBP68; CPB-II; Annexin A6/Annexin VI
Calculated MW 76kDa
Observed MW 72kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:2000 - 1:7000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, HeLa, C2C12, PC-12, C6
Cellular location Cytoplasm, Melanosome
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Annexin A6/Annexin VI Rabbit pAb images

ABclonal:Western blot - Annexin A6/Annexin VI Rabbit pAb (A5390)}

Western blot - Annexin A6/Annexin VI Rabbit pAb (A5390)

Western blot analysis of various lysates, using Annexin A6/Annexin VI Rabbit pAb (A5390) at 1:6000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A5390 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ANXA6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ANXA6. (Distance between topics and target gene indicate popularity.) ANXA6

* Data provided by citexs.com, for reference only.

Publishing research using A5390? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order