Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Annexin A11 Rabbit pAb (A7423)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Annexin A11  Rabbit pAb (A7423)

Western blot analysis of lysates from Rat heart , using Annexin A11 Rabbit pAb (A7423) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - Annexin A11  Rabbit pAb (A7423)

Immunofluorescence analysis of PC-12 cells using Annexin A11 Rabbit pAb (A7423) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Annexin A11  Rabbit pAb (A7423)

Immunofluorescence analysis of U2OS cells using Annexin A11 Rabbit pAb (A7423) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Annexin A11  Rabbit pAb (A7423)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells, using 3 μg Annexin A11 antibody (A7423). Western blot was performed from the immunoprecipitate using Annexin A11 antibody (A7423) at a dilution of 1:1000.

You may also interested in:

Overview

Product name Annexin A11 Rabbit pAb
Catalog No. A7423
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 276-505 of human Annexin A11 (NP_001148.1).
Sequence FDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
Gene ID 311
Swiss prot P50995
Synonyms ALS23; ANX11; CAP50; CAP-50; IBMWMA; Annexin A11
Calculated MW 54kDa
Observed MW 56kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples Rat heart
Cellular location Cytoplasm, Melanosome, Nucleus, Nucleus envelope, cytoskeleton, nucleoplasm, spindle

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Annexin A11 Rabbit pAb images

ABclonal:Western blot - Annexin A11  Rabbit pAb (A7423)}

Western blot - Annexin A11 Rabbit pAb (A7423)

Western blot analysis of lysates from Rat heart , using Annexin A11 Rabbit pAb (A7423) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - Annexin A11  Rabbit pAb (A7423)}

Immunofluorescence - Annexin A11 Rabbit pAb (A7423)

Immunofluorescence analysis of PC-12 cells using Annexin A11 Rabbit pAb (A7423) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Annexin A11  Rabbit pAb (A7423)}

Immunofluorescence - Annexin A11 Rabbit pAb (A7423)

Immunofluorescence analysis of U2OS cells using Annexin A11 Rabbit pAb (A7423) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - Annexin A11  Rabbit pAb (A7423)}

Immunoprecipitation - Annexin A11 Rabbit pAb (A7423)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells, using 3 μg Annexin A11 antibody (A7423). Western blot was performed from the immunoprecipitate using Annexin A11 antibody (A7423) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A7423 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ANXA11. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ANXA11. (Distance between topics and target gene indicate popularity.) ANXA11

* Data provided by citexs.com, for reference only.

Publishing research using A7423? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order