Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Annexin A11 Rabbit pAb |
---|---|
Catalog No. | A7423 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 276-505 of human Annexin A11 (NP_001148.1). |
---|---|
Sequence | FDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND |
Gene ID | 311 |
Swiss prot | P50995 |
Synonyms | ALS23; ANX11; CAP50; CAP-50; IBMWMA; Annexin A11 |
Calculated MW | 54kDa |
Observed MW | 56kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | Rat heart |
Cellular location | Cytoplasm, Melanosome, Nucleus, Nucleus envelope, cytoskeleton, nucleoplasm, spindle |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A7423 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on ANXA11. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to ANXA11. (Distance between topics and target gene indicate popularity.) ANXA11
* Data provided by citexs.com, for reference only.
Publishing research using A7423? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.