Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ALDH1A2 Rabbit pAb (A7503)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ALDH1A2 Rabbit pAb (A7503)

Western blot analysis of extracts of various cell lines, using ALDH1A2 antibody (A7503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - ALDH1A2 Rabbit pAb (A7503)

Immunohistochemistry analysis of paraffin-embedded rat kidney using ALDH1A2 antibody (A7503) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ALDH1A2 Rabbit pAb (A7503)

Immunofluorescence analysis of C6 cells using ALDH1A2 antibody (A7503) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ALDH1A2 Rabbit pAb (A7503)

Immunofluorescence analysis of NIH-3T3 cells using ALDH1A2 antibody (A7503) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ALDH1A2 Rabbit pAb
Catalog No. A7503
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ALDH1A2 (NP_733797.1).
Sequence MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
Gene ID 8854
Swiss prot O94788
Synonyms DIH4; RALDH2; RALDH2-T; RALDH(II); ALDH1A2
Calculated MW 57kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SW620, 293T, Mouse liver, Mouse kidney, Mouse testis, Mouse lung, Rat liver
Cellular location Cytoplasm
Customer validation

IF (Danio rerio)

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ALDH1A2 Rabbit pAb images

ABclonal:Western blot - ALDH1A2 Rabbit pAb (A7503)}

Western blot - ALDH1A2 Rabbit pAb (A7503)

Western blot analysis of extracts of various cell lines, using ALDH1A2 antibody (A7503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - ALDH1A2 Rabbit pAb (A7503)}

Immunohistochemistry - ALDH1A2 Rabbit pAb (A7503)

Immunohistochemistry analysis of paraffin-embedded rat kidney using ALDH1A2 antibody (A7503) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ALDH1A2 Rabbit pAb (A7503)}

Immunofluorescence - ALDH1A2 Rabbit pAb (A7503)

Immunofluorescence analysis of C6 cells using ALDH1A2 antibody (A7503) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ALDH1A2 Rabbit pAb (A7503)}

Immunofluorescence - ALDH1A2 Rabbit pAb (A7503)

Immunofluorescence analysis of NIH-3T3 cells using ALDH1A2 antibody (A7503) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7503 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ALDH1A2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ALDH1A2. (Distance between topics and target gene indicate popularity.) ALDH1A2

* Data provided by citexs.com, for reference only.

Publishing research using A7503? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order