Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ACTN1 Rabbit pAb (A1160)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ACTN1 Rabbit pAb (A1160)

Western blot analysis of NIH/3T3, using ACTN1 antibody (A1160) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - ACTN1 Rabbit pAb (A1160)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using ACTN1 antibody (A1160) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ACTN1 Rabbit pAb (A1160)

Immunohistochemistry analysis of paraffin-embedded human esophagus using ACTN1 antibody (A1160) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ACTN1 Rabbit pAb (A1160)

Immunohistochemistry analysis of paraffin-embedded mouse heart using ACTN1 antibody (A1160) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name ACTN1 Rabbit pAb
Catalog No. A1160
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human ACTN1 (NP_001123477.1).
Sequence MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQE
Gene ID 87
Swiss prot P12814
Synonyms BDPLT15; ACTN1
Calculated MW 103kDa
Observed MW 103kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples NIH/3T3
Cellular location Cell junction, Cell membrane, Cell projection, Cytoplasm, Z line, cytoskeleton, myofibril, ruffle, sarcomere
Customer validation

ICC (Homo sapiens)

IF (Homo sapiens, Gallus gallus)

WB (Mus musculus, Danio rerio, Gallus gallus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ACTN1 Rabbit pAb images

ABclonal:Western blot - ACTN1 Rabbit pAb (A1160)}

Western blot - ACTN1 Rabbit pAb (A1160)

Western blot analysis of NIH/3T3, using ACTN1 antibody (A1160) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - ACTN1 Rabbit pAb (A1160)}

Immunohistochemistry - ACTN1 Rabbit pAb (A1160)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using ACTN1 antibody (A1160) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ACTN1 Rabbit pAb (A1160)}

Immunohistochemistry - ACTN1 Rabbit pAb (A1160)

Immunohistochemistry analysis of paraffin-embedded human esophagus using ACTN1 antibody (A1160) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ACTN1 Rabbit pAb (A1160)}

Immunohistochemistry - ACTN1 Rabbit pAb (A1160)

Immunohistochemistry analysis of paraffin-embedded mouse heart using ACTN1 antibody (A1160) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1160 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ACTN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ACTN1. (Distance between topics and target gene indicate popularity.) ACTN1

* Data provided by citexs.com, for reference only.

Publishing research using A1160? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order