Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ACADL Rabbit pAb (A1266)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ACADL Rabbit pAb (A1266)

Western blot analysis of extracts of various cell lines, using ACADL antibody (A1266) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - ACADL Rabbit pAb (A1266)

Immunohistochemistry analysis of paraffin-embedded rat ovary using ACADL antibody (A1266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ACADL Rabbit pAb (A1266)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using ACADL antibody (A1266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - ACADL Rabbit pAb (A1266)

Immunohistochemistry analysis of paraffin-embedded mouse heart using ACADL antibody (A1266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name ACADL Rabbit pAb
Catalog No. A1266
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 31-210 of human ACADL (NP_001599.1).
Sequence GGEERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGGIGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIPQMTAGKCIGAIAMTEPGAGSDLQGIKTNAKKDGSDWILNGSKVFISNGSLS
Gene ID 33
Swiss prot P28330
Synonyms LCAD; ACAD4; ACADL
Calculated MW 48kDa
Observed MW 47kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples SH-SY5Y, Mouse liver, Mouse kidney, Mouse heart, Rat spinal cord
Cellular location Mitochondrion matrix
Customer validation

WB (Mus musculus, Homo sapiens, Oryctolagus cuniculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ACADL Rabbit pAb images

ABclonal:Western blot - ACADL Rabbit pAb (A1266)}

Western blot - ACADL Rabbit pAb (A1266)

Western blot analysis of extracts of various cell lines, using ACADL antibody (A1266) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - ACADL Rabbit pAb (A1266)}

Immunohistochemistry - ACADL Rabbit pAb (A1266)

Immunohistochemistry analysis of paraffin-embedded rat ovary using ACADL antibody (A1266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ACADL Rabbit pAb (A1266)}

Immunohistochemistry - ACADL Rabbit pAb (A1266)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using ACADL antibody (A1266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - ACADL Rabbit pAb (A1266)}

Immunohistochemistry - ACADL Rabbit pAb (A1266)

Immunohistochemistry analysis of paraffin-embedded mouse heart using ACADL antibody (A1266) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1266 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ACADL. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ACADL. (Distance between topics and target gene indicate popularity.) ACADL

* Data provided by citexs.com, for reference only.

Publishing research using A1266? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order