Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ABCG1 Rabbit pAb (A4328)

Publications (6) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - ABCG1 Rabbit pAb (A4328)

Western blot analysis of various lysates, using ABCG1 Rabbit pAb (A4328) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - ABCG1 Rabbit pAb (A4328)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ABCG1 Rabbit pAb (A4328) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ABCG1 Rabbit pAb (A4328)

Immunofluorescence analysis of Rat lung using ABCG1 antibody (A4328) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ABCG1 Rabbit pAb
Catalog No. A4328
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 6-120 of human ABCG1 (NP_004906.3).
Sequence AAFSVGTAMNASSYSAEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPS
Gene ID 9619
Swiss prot P45844
Synonyms ABC8; WHITE1; ABCG1
Calculated MW 76kDa
Observed MW 75kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HUVEC, A-549, RAW264.7
Cellular location Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein
Customer validation

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABCG1 Rabbit pAb images

ABclonal:Western blot - ABCG1 Rabbit pAb (A4328)}

Western blot - ABCG1 Rabbit pAb (A4328)

Western blot analysis of various lysates, using ABCG1 Rabbit pAb (A4328) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Immunohistochemistry - ABCG1 Rabbit pAb (A4328)}

Immunohistochemistry - ABCG1 Rabbit pAb (A4328)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using ABCG1 Rabbit pAb (A4328) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ABCG1 Rabbit pAb (A4328)}

Immunofluorescence - ABCG1 Rabbit pAb (A4328)

Immunofluorescence analysis of Rat lung using ABCG1 antibody (A4328) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A4328 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ABCG1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ABCG1. (Distance between topics and target gene indicate popularity.) ABCG1

* Data provided by citexs.com, for reference only.

Publishing research using A4328? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order