Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ABCD1 Rabbit pAb (A12141)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ABCD1 Rabbit pAb (A12141)

Western blot analysis of various lysates using ABCD1 Rabbit pAb (A12141) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - ABCD1 Rabbit pAb (A12141)

Immunofluorescence analysis of NIH/3T3 cells using ABCD1 Rabbit pAb (A12141) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ABCD1 Rabbit pAb
Catalog No. A12141
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein is likely involved in the peroxisomal transport or catabolism of very long chain fatty acids. Defects in this gene have been identified as the underlying cause of adrenoleukodystrophy, an X-chromosome recessively inherited demyelinating disorder of the nervous system.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-500 of human ABCD1 (NP_000024.2).
Sequence SASGLLMVAVPIITATGYSESDAEAVKKAALEKKEEELVSERTEAFTIARNLLTAAADAIERIMSSYKEVTELAGYTARVHEMFQVFEDVQRCHFKRPRELEDAQAGSGTIGRSGVRVEGPLKIRGQVVDVEQGIICENIPIVTPSGEVVVASLNIRVEEG
Gene ID 215
Swiss prot P33897
Synonyms ALD; AMN; ALDP; ABC42; ABCD1
Calculated MW 83kDa
Observed MW 83kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples LO2, U-87MG, HeLa
Cellular location Multi-pass membrane protein, Peroxisome membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ABCD1 Rabbit pAb images

ABclonal:Western blot - ABCD1 Rabbit pAb (A12141)}

Western blot - ABCD1 Rabbit pAb (A12141)

Western blot analysis of various lysates using ABCD1 Rabbit pAb (A12141) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - ABCD1 Rabbit pAb (A12141)}

Immunofluorescence - ABCD1 Rabbit pAb (A12141)

Immunofluorescence analysis of NIH/3T3 cells using ABCD1 Rabbit pAb (A12141) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A12141 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ABCD1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ABCD1. (Distance between topics and target gene indicate popularity.) ABCD1

* Data provided by citexs.com, for reference only.

Publishing research using A12141? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order