Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

14-3-3 sigma Rabbit mAb (A4377)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - 14-3-3 sigma Rabbit mAb (A4377)

Western blot analysis of extracts of various cell lines, using 14-3-3 sigma Rabbit mAb (A4377) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - 14-3-3 sigma Rabbit mAb (A4377)

Immunohistochemistry analysis of paraffin-embedded human colon using 14-3-3 sigma Rabbit mAb (A4377) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name 14-3-3 sigma Rabbit mAb
Catalog No. A4377
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0988

Background

This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 sigma (P31947).
Sequence MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL
Gene ID 2810
Swiss prot P31947
Synonyms YWHAS; 14-3-3 sigma
Calculated MW 28kDa
Observed MW 29kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
IHC-P Human
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A-431, Mouse lung, Mouse kidney
Cellular location Cytoplasm, Nucleus, Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

14-3-3 sigma Rabbit mAb images

ABclonal:Western blot - 14-3-3 sigma Rabbit mAb (A4377)}

Western blot - 14-3-3 sigma Rabbit mAb (A4377)

Western blot analysis of extracts of various cell lines, using 14-3-3 sigma Rabbit mAb (A4377) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunohistochemistry - 14-3-3 sigma Rabbit mAb (A4377)}

Immunohistochemistry - 14-3-3 sigma Rabbit mAb (A4377)

Immunohistochemistry analysis of paraffin-embedded human colon using 14-3-3 sigma Rabbit mAb (A4377) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A4377 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SFN. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SFN. (Distance between topics and target gene indicate popularity.) SFN

* Data provided by citexs.com, for reference only.

Publishing research using A4377? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order