Products / Genes / Cardiovascular / Angiogenesis

Rhesus FGF7 / FGF-7 / KGF Gene ORF cDNA clone in cloning vector

Summary
Catalog No:CG90071-G
NCBI RefSeq:585 bp
Type:cDNA clones
Gene ID:

To buy,select size,quantity

Background

Rhesus FGF7 / FGF-7 / KGF Gene ORF cDNA clone in cloning vector Product information

Molecule NameFGF7
RefSeq ORF Size585 bp
cDNA DescriptionRhesus FGF7 / FGF-7 / KGF Gene ORF cDNA clone in cloning vector (CG90071-G) - available for purchase from ABclonal - allows for easy subcloning of the ORF (pGEM-T Vector Vector) to other plasmid vectors.
Synonym
VectorpGEM-T Vector
PlasimidpGEM-cynoFGF7
Restriction site
Tag Sequence
Sequence DescriptionIdentical with the Gene Bank Ref. ID sequence. Please check the sequence information before order.
Sequencing primersSP6 and T7 or M13-47 and RV-M
Promoter
Application
Antibiotic in E.coliAmpicillin
Antibiotic in mammalian cell
Shipping carrierEach tube contains lyophilized plasmid.
StorageThe lyophilized plasmid can be stored at ambient temperature for three months.

Neucleotide sequence and amino acid sequence

 
ATGCACAAATGGATACTGACATGGATCCTGCCAACTTTGCTCTACAGATCATGCTTTCACATTATCTGTCTAGTGGGTACTATATCTTTAGCTTGCAATGACATGACTCCAGAGCAAATGGCTACAAATGTGAACTGTTCCAGCCCTGAGCGACACACAAGAAGTTATGATTACATGGAAGGAGGGGATATAAGAGTGAGAAGACTCTTCTGTCGAACACAGTGGTATCTGAGGATTGATAAAAGAGGCAAAGTAAAAGGGACCCAAGAGATGAAGAATAATTACAATATCATGGAAATCAGGACAGTGGCAGTCGGAATTGTGGCAATCAAAGGGGTGGAAAGTGAATTCTATCTTGCAATGAACAAGGAAGGAAAACTCTATGCAAAGAAAGAATGCAATGAAGATTGTAACTTCAAAGAACTAATTCTGGAAAACCATTACAACACATATGCATCAGCTAAATGGACACACAATGGAGGGGAAATGTTTGTTGCCTTAAATCAAAAGGGGATTCCTGTAAGAGGAAAAAAAACGAAGAAAGAACAAAAAACAGCCCACTTTCTTCCTATGGCAATAACTTAA
 
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT-

Ask Us About This Product

submit your question on CG90071-G below

During business hours, we will respond to your email with in 24 hours. For any questions submitted on the weekend, a response will be received on Monday.

For immediate assistance during business hours M-F (excluding major holidays), please contact us.

You Viewed