Products / Genes / Virus / Coronaviridae

MERS CoV Plpro Gene cDNA clone plasmid

Summary
Catalog No:VG40522-G
NCBI RefSeq:1140 bp
Type:cDNA clones
Gene ID:

To buy,select size,quantity

Background

MERS CoV Plpro Gene cDNA clone plasmid Product information

Molecule NamePLpro
RefSeq ORF Size1140 bp
cDNA DescriptionMERS CoV Plpro Gene cDNA clone plasmid (VG40522-G) - available for purchase from ABclonal - allows for easy subcloning of the ORF (pGEM-T Vector Vector) to other plasmid vectors.
Synonym
VectorpGEM-T Vector
PlasimidpGEM-MERS-CoV-AFS88944-PLpro
Restriction site
Tag Sequence
Sequence DescriptionIdentical with the Gene Bank Ref. ID sequence.
Sequencing primersSP6 and T7 or M13-47 and RV-M
Promoter
Application
Antibiotic in E.coliAmpicillin
Antibiotic in mammalian cell
Shipping carrierEach tube contains lyophilized plasmid.
StorageThe lyophilized plasmid can be stored at ambient temperature for three months.

Neucleotide sequence and amino acid sequence

 
TTAACAATCGAAGTCTTAGTGACTGTCGATGGTGTAAATTTTAGAACAGTCGTTCTAAATAATAAGAACACTTATAGATCACAGCTTGGATGCGTTTTCTTTAATGGTGCTGATATTTCTGACACCATTCCTGATGAGAAACAGAATGGTCACAGTTTATATCTAGCAGACAATTTGACTGCTGATGAAACAAAGGCGCTTAAAGAGTTATATGGCCCCGTTGATCCTACTTTCTTACACAGATTCTATTCACTTAAGGCTGCAGTCCATGGGTGGAAGATGGTTGTGTGTGATAAGGTACGTTCTCTCAAATTGAGTGATAATAATTGTTATCTTAATGCAGTTATTATGACACTTGATTTATTGAAGGACATTAAATTTGTTATACCTGCTCTACAGCATGCATTTATGAAACATAAGGGCGGTGATTCAACTGACTTCATAGCCCTCATTATGGCTTATGGCAATTGCACATTTGGTGCTCCAGATGATGCCTCTCGGTTACTTCATACCGTGCTTGCAAAGGCTGAGTTATGCTGTTCTGCACGCATGGTTTGGAGAGAGTGGTGCAATGTCTGTGGCATAAAAGATGTTGTTCTACAAGGCTTAAAAGCTTGTTGTTACGTGGGTGTGCAAACTGTTGAAGATCTGCGTGCTCGCATGACATATGTATGCCAGTGTGGTGGTGAACGTCATCGGCAATTAGTCGAACACACCACCCCCTGGTTGCTGCTCTCAGGCACACCAAATGAAAAATTGGTGACAACCTCCACGGCGCCTGATTTTGTAGCATTTAATGTCTTTCAGGGCATTGAAACGGCTGTTGGCCATTATGTTCATGCTCGCCTGAAGGGTGGTCTTATTTTAAAGTTTGACTCTGGCACCGTTAGCAAGACTTCAGACTGGAAGTGCAAGGTGACAGATGTACTTTTCCCCGGCCAAAAATACAGTAGCGATTGTAATGTCGTACGGTATTCTTTGGACGGTAATTTCAGAACAGAGGTTGATCCCGACCTATCTGCTTTCTATGTTAAGGATGGTAAATACTTTACAAGTGAACCACCCGTAACATATTCACCAGCTACAATTTTAGCTGGTAGTGTCTACACTAATAGCTGCCTTGTATCGTCTGATGGACAA
 
LTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPATILAGSVYTNSCLVSSDGQ

Ask Us About This Product

submit your question on VG40522-G below

During business hours, we will respond to your email with in 24 hours. For any questions submitted on the weekend, a response will be received on Monday.

For immediate assistance during business hours M-F (excluding major holidays), please contact us.

You Viewed