Products / Genes / Cell Biology / Apoptosis(C)

Human IFNA5/IFNaG Gene ORF cDNA clone in cloning vector

Summary
Catalog No:HG10342-M
NCBI RefSeq:570 bp
Type:cDNA clones
Gene ID:

To buy,select size,quantity

Background

Interferon, alpha 5 (IFNA5) belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha, the first cytokine to be produced by recombinant DNA technology, has emerged as an important regulator of growth and differentiation, affecting cellular communication and signal transduction pathways as well as immunological control. Originally discovered as an antiviral substance, the efficacy of IFN-alpha in malignant, viral, immunological, angiogenic, inflammatory, and fibrotic diseases sµggests a spectrum of interrelated pathophysiologies. IFN-alpha emerged as a prototypic tumor suppressor protein that represses the clinical tumorigenic phenotype in some malignancies capable of differentiation.

Human IFNA5/IFNaG Gene ORF cDNA clone in cloning vector Product information

Molecule NameIFNA5
RefSeq ORF Size570 bp
cDNA DescriptionHuman IFNA5/IFNaG Gene ORF cDNA clone in cloning vector (HG10342-M) - available for purchase from ABclonal - allows for easy subcloning of the ORF (pMD18-T Simple Vector Vector) to other plasmid vectors.
SynonymIFN-alpha-5, IFN-alphaG, INA5, INFA5, leIF G, RP11-380P16.5
VectorpMD18-T Simple Vector
PlasimidpMD-IFNαG
Restriction site
Tag Sequence
Sequence DescriptionIdentical with the Gene Bank Ref. ID sequence.
Sequencing primersM13-47 and RV-M
Promoter
Application
Antibiotic in E.coliAmpicillin
Antibiotic in mammalian cell
Shipping carrierEach tube contains lyophilized plasmid.
StorageThe lyophilized plasmid can be stored at ambient temperature for three months.

Neucleotide sequence and amino acid sequence

 
ATGGCCTTGCCCTTTGTTTTACTGATGGCCCTGGTGGTGCTCAACTGCAAGTCAATCTGTTCTCTGGGCTGTGATCTGCCTCAGACCCACAGCCTGAGTAACAGGAGGACTTTGATGATAATGGCACAAATGGGAAGAATCTCTCCTTTCTCCTGCCTGAAGGACAGACATGACTTTGGATTTCCTCAGGAGGAGTTTGATGGCAACCAGTTCCAGAAGGCTCAAGCCATCTCTGTCCTCCATGAGATGATCCAGCAGACCTTCAATCTCTTCAGCACAAAGGACTCATCTGCTACTTGGGATGAGACACTTCTAGACAAATTCTACACTGAACTTTACCAGCAGCTGAATGACCTGGAAGCCTGTATGATGCAGGAGGTTGGAGTGGAAGACACTCCTCTGATGAATGTGGACTCTATCCTGACTGTGAGAAAATACTTTCAAAGAATCACCCTCTATCTGACAGAGAAGAAATACAGCCCTTGTGCATGGGAGGTTGTCAGAGCAGAAATCATGAGATCCTTCTCTTTATCAGCAAACTTGCAAGAAAGATTAAGGAGGAAGGAATGA
 
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE-

Ask Us About This Product

submit your question on HG10342-M below

During business hours, we will respond to your email with in 24 hours. For any questions submitted on the weekend, a response will be received on Monday.

For immediate assistance during business hours M-F (excluding major holidays), please contact us.

You Viewed