Products / Genes / Epigenetics / Apoptosis(E)

Human CEACAM7 transcript variant 2 Gene ORF cDNA clone expression plasmid

Summary
Catalog No:HG11974-UT
NCBI RefSeq:798 bp
Type:Expression-Ready ORF Clones
Gene ID:

To buy,select size,quantity

Background

Human CEACAM7 transcript variant 2 Gene ORF cDNA clone expression plasmid Product information

Molecule NameCEACAM7
RefSeq ORF Size798 bp
cDNA DescriptionHuman CEACAM7 transcript variant 2 Gene ORF cDNA clone expression plasmid (HG11974-UT) - available for purchase from ABclonal - allows for easy subcloning of the ORF (pCMV3-untagged Vector) to other plasmid vectors.
SynonymCGM2
VectorpCMV3-untagged
PlasimidpCMV3-CEACAM7
Restriction siteKpnI + XbaI (6.1kb + 0.8kb)
Tag Sequence
Sequence DescriptionIdentical with the Gene Bank Ref. ID sequence except for the point mutation: 339 T/C not causing the amino acid variation.
Sequencing primersT7(TAATACGACTCACTATAGGG) BGH(TAGAAGGCACAGTCGAGG)
PromoterEnhanced CMV mammalian cell promoter
Application
Antibiotic in E.coliAmpicillin
Antibiotic in mammalian cellHygromycin
Shipping carrierEach tube contains lyophilized plasmid.
StorageThe lyophilized plasmid can be stored at ambient temperature for three months.

Neucleotide sequence and amino acid sequence

DarkRed:Silent mutation
 
ATGGGTTCCCCTTCAGCCTGTCCATACAGAGTGTGCATTCCCTGGCAGGGGCTCCTGCTCACAGCCTCGCTTTTAACCTTCTGGAACCTGCCAAACAGTGCCCAGACCAATATTGATGTCGTGCCGTTCAATGTCGCAGAAGGGAAGGAGGTCCTTCTAGTAGTCCATAATGAGTCCCAGAATCTTTATGGCTACAACTGGTACAAAGGGGAAAGGGTGCATGCCAACTATCGAATTATAGGATATGTAAAAAATATAAGTCAAGAAAATGCCCCAGGGCCCGCACACAACGGTCGAGAGACAATATACCCCAATGGAACCCTGCTGATCCAGAACGTCACCCACAATGACGCAGGATTCTATACCCTACACGTTATAAAAGAAAATCTTGTGAATGAAGAAGTAACCAGACAATTCTACGTATTCTCGGAGCCACCCAAGCCCTCCATCACCAGCAACAACTTCAATCCGGTGGAGAACAAAGATATTGTGGTTTTAACCTGTCAACCTGAGACTCAGAACACAACCTACCTGTGGTGGGTAAACAATCAGAGCCTCCTGGTCAGTCCCAGGCTGCTGCTCTCCACTGACAACAGGACCCTCGTTCTACTCAGCGCCACAAAGAATGACATAGGACCCTATGAATGTGAAATACAGAACCCAGTGGGTGCCAGCCGCAGTGACCCAGTCACCCTGAATGTCCGCTATGAGTCAGTACAAGCAAGTTCACCTGACCTCTCAGCTGGGACCGCTGTCAGCATCATGATTGGAGTACTGGCTGGGATGGCTCTGATATAA
 
MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI-

Ask Us About This Product

submit your question on HG11974-UT below

During business hours, we will respond to your email with in 24 hours. For any questions submitted on the weekend, a response will be received on Monday.

For immediate assistance during business hours M-F (excluding major holidays), please contact us.

You Viewed