Products / Genes / Other

Green fluorescent protein / GFP Gene ORF cDNA clone expression plasmid

Summary
Catalog No:AG13105-UT
NCBI RefSeq:717 bp
Type:Expression-Ready ORF Clones
Gene ID:
Images(1)

GFP Gene Plasmid Map

To buy,select size,quantity

Background

Green fluorescent protein / GFP Gene ORF cDNA clone expression plasmid Product information

Molecule NameGFP
RefSeq ORF Size717 bp
cDNA DescriptionGreen fluorescent protein / GFP Gene ORF cDNA clone expression plasmid (AG13105-UT) - available for purchase from ABclonal - allows for easy subcloning of the ORF (pCMV3-untagged Vector) to other plasmid vectors.
Synonym
VectorpCMV3-untagged
PlasimidpCMV3-GFP
Restriction siteKpnI + XbaI (6.1kb + 0.72kb)
Tag Sequence
Sequence DescriptionA number of silent mutations were introduced into the DNA sequence in order to increase its protein expression level in mammalian cell system. The translated amino acid sequence is identical with AAX31732.1.
Sequencing primersT7(TAATACGACTCACTATAGGG) BGH(TAGAAGGCACAGTCGAGG)
PromoterEnhanced CMV mammalian cell promoter
Application
Antibiotic in E.coliAmpicillin
Antibiotic in mammalian cellHygromycin
Shipping carrierEach tube contains lyophilized plasmid.
StorageThe lyophilized plasmid can be stored at ambient temperature for three months.

Green fluorescent protein / GFP Gene ORF cDNA clone expression plasmid images

GFP Gene Plasmid Map

Neucleotide sequence and amino acid sequence

 
ATGAGCAAAGGGGAGGAACTGTTCACGGGCGTGGTGCCTATTTTGGTGGAACTGGACGGCGACGTGAACGGCCACAAGTTCAGCGTCTCAGGAGAAGGTGAGGGCGATGCGACCTATGGCAAGCTGACCCTGAAATTCATCTGCACCACTGGGAAGCTGCCGGTCCCGTGGCCGACCCTGGTGACGACATTCAGTTACGGCGTGCAATGTTTCTCGCGTTACCCGGATCACATGAAGCGGCATGACTTCTTTAAAAGCGCGATGCCGGAGGGCTACGTCCAGGAACGGACGATCTCTTTCAAGGATGACGGCAACTACAAGACTCGTGCCGAGGTCAAATTCGAAGGAGACACGCTTGTAAATCGGATTGAGCTGAAAGGGATCGACTTTAAGGAAGACGGGAACATTCTGGGCCATAAGTTGGAGTACAATTACAACTCCCACAACGTATACATCACCGCCGACAAGCAGAAAAACGGTATCAAGGCAAACTTCAAAATCCGCCACAACATCGAAGATGGATCGGTGCAGTTGGCCGATCATTACCAGCAGAACACTCCGATTGGAGACGGCCCTGTCTTGCTGCCAGATAACCACTACTTATCGACGCAATCGGCTCTGTCCAAGGACCCGAACGAAAAGCGGGACCACATGGTGTTGCTGGAATTCGTGACCGCAGCGGGGATCACGCACGGTATGGACGAACTGTACAAATAA
 
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK-

Ask Us About This Product

submit your question on AG13105-UT below

During business hours, we will respond to your email with in 24 hours. For any questions submitted on the weekend, a response will be received on Monday.

For immediate assistance during business hours M-F (excluding major holidays), please contact us.

You Viewed