Products / Genes / Other

Green fluorescent protein / GFP Gene ORF cDNA clone expression plasmid, C-GFPSpark tag

Summary
Catalog No:AG13105-ACG
NCBI RefSeq:717 bp
Type:Expression-Ready ORF Clones
Gene ID:
Images(2)

GFP Gene Plasmid Map

GFP Gene Expression validated Image

To buy,select size,quantity

Background

The green fluorescent protein (GFP) is a protein that exhibit bright green fluorescence when exposed to blue light. GFPSparkTM is an improved variant of the green fluorescent protein GFP. It possesses bright green fluorescence (excitation/ emission max = 487 / 508 nm) that is visible earlier than fluorescence of other green fluorescent proteins. GFPSparkTM is mainly intended for applications where fast appearance of bright fluorescence is crucial. Its amazing ability to generate a highly visible, efficiently emitting internal fluorophore is both intrinsically fascinating and tremendously valuable. It is specially recommended for cell and organelle labeling and tracking the promoter activity.

Green fluorescent protein / GFP Gene ORF cDNA clone expression plasmid, C-GFPSpark tag Product information

Molecule NameGFP
RefSeq ORF Size717 bp
cDNA DescriptionGreen fluorescent protein / GFP Gene ORF cDNA clone expression plasmid, C-GFPSpark tag (AG13105-ACG) - available for purchase from ABclonal - allows for easy subcloning of the ORF (pCMV3-C-GFPSpark Vector) to other plasmid vectors.
Synonym
VectorpCMV3-C-GFPSpark
PlasimidpCMV3-GFP-GFPSpark
Restriction siteKpnI + XbaI (6kb + 1.45kb)
Tag SequenceGFPSpark: GTGAGCAAGGGC……GAGCTGTACAAG
Sequence DescriptionA number of silent mutations were introduced into the DNA sequence in order to increase its protein expression level in mammalian cell system. The translated amino acid sequence is identical with AAX31732.1.
Sequencing primersT7(TAATACGACTCACTATAGGG) BGH(TAGAAGGCACAGTCGAGG)
PromoterEnhanced CMV mammalian cell promoter
Application
Antibiotic in E.coliKanamycin
Antibiotic in mammalian cellHygromycin
Shipping carrierEach tube contains lyophilized plasmid.
StorageThe lyophilized plasmid can be stored at ambient temperature for three months.

Green fluorescent protein / GFP Gene ORF cDNA clone expression plasmid, C-GFPSpark tag images

GFP Gene Plasmid Map

GFP Gene Expression validated Image

The plasmid was transfected into 293H adherent cells with Sinofection reagent (Cat#STF01) transiently. After 48 h, the fluorescent signals can be detected by fluorescence microscope. Green excitation 475/40nm, emission 535/45nm. Red excitation 560/55nm, emission 645/45nm. Orange excitation 525/45nm, emission 595/60nm.

Neucleotide sequence and amino acid sequence

Yellow:linker
Green:GFP tag
 
ATGAGCAAAGGGGAGGAACTGTTCACGGGCGTGGTGCCTATTTTGGTGGAACTGGACGGCGACGTGAACGGCCACAAGTTCAGCGTCTCAGGAGAAGGTGAGGGCGATGCGACCTATGGCAAGCTGACCCTGAAATTCATCTGCACCACTGGGAAGCTGCCGGTCCCGTGGCCGACCCTGGTGACGACATTCAGTTACGGCGTGCAATGTTTCTCGCGTTACCCGGATCACATGAAGCGGCATGACTTCTTTAAAAGCGCGATGCCGGAGGGCTACGTCCAGGAACGGACGATCTCTTTCAAGGATGACGGCAACTACAAGACTCGTGCCGAGGTCAAATTCGAAGGAGACACGCTTGTAAATCGGATTGAGCTGAAAGGGATCGACTTTAAGGAAGACGGGAACATTCTGGGCCATAAGTTGGAGTACAATTACAACTCCCACAACGTATACATCACCGCCGACAAGCAGAAAAACGGTATCAAGGCAAACTTCAAAATCCGCCACAACATCGAAGATGGATCGGTGCAGTTGGCCGATCATTACCAGCAGAACACTCCGATTGGAGACGGCCCTGTCTTGCTGCCAGATAACCACTACTTATCGACGCAATCGGCTCTGTCCAAGGACCCGAACGAAAAGCGGGACCACATGGTGTTGCTGGAATTCGTGACCGCAGCGGGGATCACGCACGGTATGGACGAACTGTACAAAGGGGGTGGAGGCTCTGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGAAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGCTAACTTCAAGGTTCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA
 
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKGGGGSVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKKHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKVRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK-

Ask Us About This Product

submit your question on AG13105-ACG below

During business hours, we will respond to your email with in 24 hours. For any questions submitted on the weekend, a response will be received on Monday.

For immediate assistance during business hours M-F (excluding major holidays), please contact us.

You Viewed