Products / Genes / Immunology / Adaptive Immunity

Cynomolgus FCRN/FCGRT Gene ORF cDNA clone expression plasmid, C-GFPSpark tag

Summary
Catalog No:CG90023-ACG
NCBI RefSeq:1098 bp
Type:Expression-Ready ORF Clones
Gene ID:
Images(2)

GFP Gene Plasmid Map

Cynomolgus FCRN/FCGRT Gene Expression validated Image

To buy,select size,quantity

Background

Cynomolgus FCRN/FCGRT Gene ORF cDNA clone expression plasmid, C-GFPSpark tag Product information

Molecule NameFCGRT
RefSeq ORF Size1098 bp
cDNA DescriptionCynomolgus FCRN/FCGRT Gene ORF cDNA clone expression plasmid, C-GFPSpark tag (CG90023-ACG) - available for purchase from ABclonal - allows for easy subcloning of the ORF (pCMV3-C-GFPSpark Vector) to other plasmid vectors.
Synonym
VectorpCMV3-C-GFPSpark
PlasimidpCMV3-cynoFCGRT-GFPSpark
Restriction siteKpnI + XbaI (6kb + 1.83kb)
Tag SequenceGFPSpark: GTGAGCAAGGGC……GAGCTGTACAAG
Sequence DescriptionIdentical with the Gene Bank Ref. ID sequence except for the point mutations: 120C/T, 543C/T, 576G/A, 1071T/C not causing the amino acid variation. Please check the sequence information before order.
Sequencing primersT7(TAATACGACTCACTATAGGG) BGH(TAGAAGGCACAGTCGAGG)
PromoterEnhanced CMV mammalian cell promoter
Application
Antibiotic in E.coliKanamycin
Antibiotic in mammalian cellHygromycin
Shipping carrierEach tube contains lyophilized plasmid.
StorageThe lyophilized plasmid can be stored at ambient temperature for three months.

Cynomolgus FCRN/FCGRT Gene ORF cDNA clone expression plasmid, C-GFPSpark tag images

GFP Gene Plasmid Map

Cynomolgus FCRN/FCGRT Gene Expression validated Image

The plasmid was transfected into 293H adherent cells with Sinofection reagent (Cat#STF01) transiently. After 48 h, the fluorescent signals can be detected by fluorescence microscope. Green excitation 475/40nm, emission 535/45nm. Red excitation 560/55nm, emission 645/45nm. Orange excitation 525/45nm, emission 595/60nm.

Neucleotide sequence and amino acid sequence

DarkRed:Silent mutation
Yellow:linker
Green:GFP tag
 
ATGAGGGTCCCGCGGCCTCAGCCCTGGGCGCTGGGGCTCCTGCTCTTTCTCCTGCCCGGGAGCCTGGGCGCAGAAAGCCACCTCTCCCTCCTGTACCACCTCACCGCGGTGTCCTCGCCTGCCCCGGGGACGCCTGCCTTCTGGGTGTCCGGCTGGCTGGGCCCGCAGCAGTACCTGAGCTACGACAGCCTGAGGGGCCAGGCGGAGCCCTGTGGAGCTTGGGTCTGGGAAAACCAAGTGTCCTGGTATTGGGAGAAAGAGACCACAGATCTGAGGATCAAGGAGAAGCTCTTTCTGGAAGCTTTCAAAGCTTTGGGGGGAAAAGGCCCCTACACTCTGCAGGGCCTGCTGGGCTGTGAACTGAGCCCTGACAACACCTCGGTGCCCACCGCCAAGTTCGCCCTGAACGGCGAGGAGTTCATGAATTTCGACCTCAAGCAGGGCACCTGGGGTGGGGACTGGCCCGAGGCCCTGGCTATCAGTCAGCGGTGGCAGCAGCAGGACAAGGCGGCCAACAAGGAGCTCACCTTCCTGCTATTCTCTTGCCCACACCGGCTGCGGGAGCACCTGGAGAGAGGCCGTGGAAACCTGGAGTGGAAGGAGCCCCCCTCCATGCGCCTGAAGGCCCGACCCGGCAACCCTGGCTTTTCCGTGCTTACCTGCAGCGCCTTCTCCTTCTACCCTCCGGAACTGCAACTGCGGTTCCTGCGGAATGGGATGGCCGCTGGCACCGGACAGGGCGACTTCGGCCCCAACAGTGACGGCTCCTTCCACGCCTCGTCGTCACTAACAGTCAAAAGTGGCGATGAGCACCACTACTGCTGCATCGTGCAGCACGCGGGGCTGGCGCAGCCCCTCAGGGTGGAGCTGGAAACTCCAGCCAAGTCCTCGGTGCTCGTGGTGGGAATCGTCATCGGTGTCTTGCTACTCACGGCAGCGGCTGTAGGAGGAGCTCTGTTGTGGAGAAGGATGAGGAGTGGGCTGCCAGCCCCTTGGATCTCCCTCCGTGGAGATGACACCGGGTCCCTCCTGCCCACCCCGGGGGAGGCCCAGGATGCTGATTCGAAGGACATAAATGTGATCCCAGCCACTGCCGGGGGTGGAGGCTCTGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGAAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGCTAACTTCAAGGTTCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA
 
MRVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGSLLPTPGEAQDADSKDINVIPATAGGGGSVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKKHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKVRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK-

Ask Us About This Product

submit your question on CG90023-ACG below

During business hours, we will respond to your email with in 24 hours. For any questions submitted on the weekend, a response will be received on Monday.

For immediate assistance during business hours M-F (excluding major holidays), please contact us.

You Viewed