Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

14-3-3 epsilon Rabbit pAb (A1058)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - 14-3-3 epsilon Rabbit pAb (A1058)

Western blot analysis of extracts of various cell lines, using 14-3-3 epsilon antibody (A1058) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)

Immunofluorescence analysis of H9C2 cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)

Immunofluorescence analysis of L929 cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)

Immunofluorescence analysis of U2OS cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name 14-3-3 epsilon Rabbit pAb
Catalog No. A1058
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1).
Sequence KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL
Gene ID 7531
Swiss prot P62258
Synonyms MDS; HEL2; MDCR; KCIP-1; 14-3-3E; 14-3-3 epsilon
Calculated MW 29kDa
Observed MW 29-32Kda

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, 293T, U-251MG, Mouse brain, Mouse kidney, Mouse lung, Rat brain, Rat kidney, Rat lung
Cellular location Cytoplasm, Melanosome
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

14-3-3 epsilon Rabbit pAb images

ABclonal:Western blot - 14-3-3 epsilon Rabbit pAb (A1058)}

Western blot - 14-3-3 epsilon Rabbit pAb (A1058)

Western blot analysis of extracts of various cell lines, using 14-3-3 epsilon antibody (A1058) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)}

Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)

Immunofluorescence analysis of H9C2 cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)}

Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)

Immunofluorescence analysis of L929 cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)}

Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)

Immunofluorescence analysis of U2OS cells using 14-3-3 epsilon antibody (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1058 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on YWHAE. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to YWHAE. (Distance between topics and target gene indicate popularity.) YWHAE

* Data provided by citexs.com, for reference only.

Publishing research using A1058? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order