Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

XRCC1 Rabbit pAb (A0442)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - XRCC1 Rabbit pAb (A0442)

Western blot analysis of extracts of various cell lines, using XRCC1 antibody (A0442) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - XRCC1 Rabbit pAb (A0442)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using XRCC1 Rabbit pAb (A0442) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - XRCC1 Rabbit pAb (A0442)

Immunohistochemistry analysis of paraffin-embedded mouse lung using XRCC1 Rabbit pAb (A0442) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - XRCC1 Rabbit pAb (A0442)

Immunofluorescence analysis of HeLa cells using XRCC1 antibody (A0442) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name XRCC1 Rabbit pAb
Catalog No. A0442
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. This protein interacts with DNA ligase III, polymerase beta and poly (ADP-ribose) polymerase to participate in the base excision repair pathway. It may play a role in DNA processing during meiogenesis and recombination in germ cells. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 480-633 of human XRCC1 (NP_006288.2).
Sequence NGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Gene ID 7515
Swiss prot P18887
Synonyms RCC; SCAR26; XRCC1
Calculated MW 69kDa
Observed MW 82kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples NIH/3T3, Jurkat, Mouse brain, Mouse kidney, Rat brain
Cellular location Nucleus
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

XRCC1 Rabbit pAb images

ABclonal:Western blot - XRCC1 Rabbit pAb (A0442)}

Western blot - XRCC1 Rabbit pAb (A0442)

Western blot analysis of extracts of various cell lines, using XRCC1 antibody (A0442) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - XRCC1 Rabbit pAb (A0442)}

Immunohistochemistry - XRCC1 Rabbit pAb (A0442)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using XRCC1 Rabbit pAb (A0442) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - XRCC1 Rabbit pAb (A0442)}

Immunohistochemistry - XRCC1 Rabbit pAb (A0442)

Immunohistochemistry analysis of paraffin-embedded mouse lung using XRCC1 Rabbit pAb (A0442) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - XRCC1 Rabbit pAb (A0442)}

Immunofluorescence - XRCC1 Rabbit pAb (A0442)

Immunofluorescence analysis of HeLa cells using XRCC1 antibody (A0442) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0442 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on XRCC1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to XRCC1. (Distance between topics and target gene indicate popularity.) XRCC1

* Data provided by citexs.com, for reference only.

Publishing research using A0442? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order