Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

WISP2 Rabbit pAb (A12541)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - WISP2 Rabbit pAb (A12541)

Immunofluorescence analysis of A-549 cells using WISP2 Rabbit pAb (A12541) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - WISP2 Rabbit pAb (A12541)

Immunofluorescence analysis of HeLa cells using WISP2 Rabbit pAb (A12541) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name WISP2 Rabbit pAb
Catalog No. A12541
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human WISP2 (NP_003872.1).
Sequence VEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Gene ID 8839
Swiss prot O76076
Synonyms CT58; WISP2; CTGF-L
Calculated MW 27kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples
Cellular location Secreted
Customer validation

WB (Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

WISP2 Rabbit pAb images

ABclonal:Immunofluorescence - WISP2 Rabbit pAb (A12541)}

Immunofluorescence - WISP2 Rabbit pAb (A12541)

Immunofluorescence analysis of A-549 cells using WISP2 Rabbit pAb (A12541) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - WISP2 Rabbit pAb (A12541)}

Immunofluorescence - WISP2 Rabbit pAb (A12541)

Immunofluorescence analysis of HeLa cells using WISP2 Rabbit pAb (A12541) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A12541 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCN5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCN5. (Distance between topics and target gene indicate popularity.) CCN5

* Data provided by citexs.com, for reference only.

Publishing research using A12541? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order