Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

VEGFB Rabbit pAb (A0544)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - VEGFB Rabbit pAb (A0544)

Western blot analysis of various lysates using VEGFB Rabbit pAb (A0544) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Western blot - VEGFB Rabbit pAb (A0544)

Western blot analysis of lysates from Rat kidney , using VEGFB Rabbit pAb (A0544) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name VEGFB Rabbit pAb
Catalog No. A0544
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the PDGF (platelet-derived growth factor)/VEGF (vascular endothelial growth factor) family. The VEGF family members regulate the formation of blood vessels and are involved in endothelial cell physiology. This member is a ligand for VEGFR-1 (vascular endothelial growth factor receptor 1) and NRP-1 (neuropilin-1). Studies in mice showed that this gene was co-expressed with nuclear-encoded mitochondrial genes and the encoded protein specifically controlled endothelial uptake of fatty acids. Alternatively spliced transcript variants encoding distinct isoforms have been identified.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-100 of mouse VEGFB (NP_035827.1).
Sequence DVYARATCQPREVVVPLSMELMGNVVKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQ
Gene ID 7423
Swiss prot P49765
Synonyms VRF; VEGFL; VEGFB
Calculated MW 22kDa
Observed MW 32kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples BxPC-3, RD, Rat kidney
Cellular location Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

VEGFB Rabbit pAb images

ABclonal:Western blot - VEGFB Rabbit pAb (A0544)}

Western blot - VEGFB Rabbit pAb (A0544)

Western blot analysis of various lysates using VEGFB Rabbit pAb (A0544) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Western blot - VEGFB Rabbit pAb (A0544)}

Western blot - VEGFB Rabbit pAb (A0544)

Western blot analysis of lysates from Rat kidney , using VEGFB Rabbit pAb (A0544) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A0544 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on VEGFB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to VEGFB. (Distance between topics and target gene indicate popularity.) VEGFB

* Data provided by citexs.com, for reference only.

Publishing research using A0544? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Proteins (1)

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order