Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UBC Rabbit pAb (A3207)

Review (1) Publications (14) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - UBC Rabbit pAb (A3207)

Western blot analysis of various lysates using UBC Rabbit pAb (A3207) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 45s.

ABclonal:Immunohistochemistry - UBC Rabbit pAb (A3207)

Immunohistochemistry analysis of UBC in paraffin-embedded mouse large intestine tissue using UBC Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - UBC Rabbit pAb (A3207)

Immunohistochemistry analysis of UBC in paraffin-embedded human spleen tissue using UBC Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - UBC Rabbit pAb (A3207)

Immunohistochemistry analysis of UBC in paraffin-embedded rat large intestine tissue using UBC Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - UBC Rabbit pAb (A3207)

Immunofluorescence analysis of HepG2 cells using UBC Rabbit pAb (A3207) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for UBC Rabbit pAb(A3207)

You may also interested in:

Overview

Product name UBC Rabbit pAb
Catalog No. A3207
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene represents a ubiquitin gene, ubiquitin C. The encoded protein is a polyubiquitin precursor. Conjugation of ubiquitin monomers or polymers can lead to various effects within a cell, depending on the residues to which ubiquitin is conjugated. Ubiquitination has been associated with protein degradation, DNA repair, cell cycle regulation, kinase modification, endocytosis, and regulation of other cell signaling pathways.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBC (NP_066289.3).
Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Gene ID 7316
Swiss prot P0CG48
Synonyms HMG20; UBC
Calculated MW 77kDa
Observed MW 12-55kDa/11-77kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, BT-474, HepG2, U-251MG, A-549, Mouse testis, Mouse liver, Rat testis, Rat brain, 293F, Hep G2, Mouse testis, Mouse liver, Rat testis
Cellular location Cytoplasm, Nucleus
Customer validation

IF (Mouse bv2)

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

UBC Rabbit pAb images

ABclonal:Western blot - UBC Rabbit pAb (A3207)}

Western blot - UBC Rabbit pAb (A3207)

Western blot analysis of various lysates using UBC Rabbit pAb (A3207) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 45s.
ABclonal:Immunohistochemistry - UBC Rabbit pAb (A3207)}

Immunohistochemistry - UBC Rabbit pAb (A3207)

Immunohistochemistry analysis of UBC in paraffin-embedded mouse large intestine tissue using UBC Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - UBC Rabbit pAb (A3207)}

Immunohistochemistry - UBC Rabbit pAb (A3207)

Immunohistochemistry analysis of UBC in paraffin-embedded human spleen tissue using UBC Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - UBC Rabbit pAb (A3207)}

Immunohistochemistry - UBC Rabbit pAb (A3207)

Immunohistochemistry analysis of UBC in paraffin-embedded rat large intestine tissue using UBC Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - UBC Rabbit pAb (A3207)}

Immunofluorescence - UBC Rabbit pAb (A3207)

Immunofluorescence analysis of HepG2 cells using UBC Rabbit pAb (A3207) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A3207

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A3207 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UBC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UBC. (Distance between topics and target gene indicate popularity.) UBC

* Data provided by citexs.com, for reference only.

Publishing research using A3207? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order