Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

U2AF2/U2AF65 Rabbit pAb (A1936)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - U2AF2/U2AF65 Rabbit pAb (A1936)

Western blot analysis of various lysates using U2AF2/U2AF65 Rabbit pAb (A1936) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunofluorescence analysis of U2OS cells using U2AF2/U2AF65 Rabbit pAb (A1936). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunoprecipitation analysis of 200 μg extracts of SW620 cells using 1 μg U2AF2/U2AF65 antibody (A1936). Western blot was performed from the immunoprecipitate using U2AF2/U2AF65 antibody (A1936) at a dilution of 1:500.

Review
ABclonal: review for U2AF2/U2AF65 Rabbit pAb(A1936)

You may also interested in:

Overview

Product name U2AF2/U2AF65 Rabbit pAb
Catalog No. A1936
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 192-471 of human U2AF2/U2AF65 (NP_001012496.1).
Sequence NQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Gene ID 11338
Swiss prot P26368
Synonyms U2AF65; U2AF2/U2AF65
Calculated MW 54kDa
Observed MW 54kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples Jurkat, SW620, Mouse spleen
Cellular location Nucleus
Customer validation

WB (Human cells)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

U2AF2/U2AF65 Rabbit pAb images

ABclonal:Western blot - U2AF2/U2AF65 Rabbit pAb (A1936)}

Western blot - U2AF2/U2AF65 Rabbit pAb (A1936)

Western blot analysis of various lysates using U2AF2/U2AF65 Rabbit pAb (A1936) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunofluorescence - U2AF2/U2AF65 Rabbit pAb (A1936)}

Immunofluorescence - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunofluorescence analysis of U2OS cells using U2AF2/U2AF65 Rabbit pAb (A1936). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - U2AF2/U2AF65 Rabbit pAb (A1936)}

Immunoprecipitation - U2AF2/U2AF65 Rabbit pAb (A1936)

Immunoprecipitation analysis of 200 μg extracts of SW620 cells using 1 μg U2AF2/U2AF65 antibody (A1936). Western blot was performed from the immunoprecipitate using U2AF2/U2AF65 antibody (A1936) at a dilution of 1:500.

Submit an review for A1936

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1936 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on U2AF2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to U2AF2. (Distance between topics and target gene indicate popularity.) U2AF2

* Data provided by citexs.com, for reference only.

Publishing research using A1936? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order