Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TEAD4 Rabbit pAb (A4151)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TEAD4 Rabbit pAb (A4151)

Western blot analysis of extracts of various cell lines, using TEAD4 antibody (A4151) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name TEAD4 Rabbit pAb
Catalog No. A4151
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human TEAD4 (NP_003204.2).
Sequence AREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHI
Gene ID 7004
Swiss prot Q15561
Synonyms TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; TCF13L1; hRTEF-1B; TEAD4
Calculated MW 48kDa
Observed MW 48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HepG2, K-562, SW620, HeLa, Mouse lung, Mouse skeletal muscle, Mouse liver, Rat lung, Rat liver
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

IHC (Homo sapiens)

Co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TEAD4 Rabbit pAb images

ABclonal:Western blot - TEAD4 Rabbit pAb (A4151)}

Western blot - TEAD4 Rabbit pAb (A4151)

Western blot analysis of extracts of various cell lines, using TEAD4 antibody (A4151) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A4151 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TEAD4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TEAD4. (Distance between topics and target gene indicate popularity.) TEAD4

* Data provided by citexs.com, for reference only.

Publishing research using A4151? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order