Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TEAD1 Rabbit pAb (A6768)

Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TEAD1 Rabbit pAb (A6768)

Western blot analysis of lysates from Rat lung using TEAD1 Rabbit pAb(A6768) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.

ABclonal:Immunohistochemistry - TEAD1 Rabbit pAb (A6768)

Immunohistochemistry analysis of TEAD1 in paraffin-embedded human liver using TEAD1 Rabbit pAb (A6768) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TEAD1 Rabbit pAb (A6768)

Immunohistochemistry analysis of TEAD1 in paraffin-embedded human lung using TEAD1 Rabbit pAb (A6768) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TEAD1 Rabbit pAb (A6768)

Immunofluorescence analysis of MCF7 cells using TEAD1 Rabbit pAb (A6768).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

ABclonal:Immunoprecipitation - TEAD1 Rabbit pAb (A6768)

Immunoprecipitation of TEAD1 in 600 µg extracts from mouse heart using 3 µg TEAD1 Rabbit pAb (A6768). Western blot analysis was performed using TEAD1 Rabbit pAb (A6768) at 1:200 dilution.

ABclonal:Chromatin Immunoprecipitation - TEAD1 Rabbit pAb (A6768)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TEAD1 antibody (A6768) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

You may also interested in:

Overview

Product name TEAD1 Rabbit pAb
Catalog No. A6768
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2).
Sequence AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
Gene ID 7003
Swiss prot P28347
Synonyms AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TEAD1
Calculated MW 48kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
  • ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples Rat lung
Cellular location Nucleus
Customer validation

WB (Homo sapiens, Mus musculus, Xenopus laevis)

IHC (Homo sapiens)

RT-qPCR (Homo sapiens)

IF (Mus musculus)

ChIP (Mus musculus)

Co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TEAD1 Rabbit pAb images

ABclonal:Western blot - TEAD1 Rabbit pAb (A6768)}

Western blot - TEAD1 Rabbit pAb (A6768)

Western blot analysis of lysates from Rat lung using TEAD1 Rabbit pAb(A6768) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:90s.
ABclonal:Immunohistochemistry - TEAD1 Rabbit pAb (A6768)}

Immunohistochemistry - TEAD1 Rabbit pAb (A6768)

Immunohistochemistry analysis of TEAD1 in paraffin-embedded human liver using TEAD1 Rabbit pAb (A6768) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TEAD1 Rabbit pAb (A6768)}

Immunohistochemistry - TEAD1 Rabbit pAb (A6768)

Immunohistochemistry analysis of TEAD1 in paraffin-embedded human lung using TEAD1 Rabbit pAb (A6768) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - TEAD1 Rabbit pAb (A6768)}

Immunofluorescence - TEAD1 Rabbit pAb (A6768)

Immunofluorescence analysis of MCF7 cells using TEAD1 Rabbit pAb (A6768).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.
ABclonal:Immunoprecipitation - TEAD1 Rabbit pAb (A6768)}

Immunoprecipitation - TEAD1 Rabbit pAb (A6768)

Immunoprecipitation of TEAD1 in 600 µg extracts from mouse heart using 3 µg TEAD1 Rabbit pAb (A6768). Western blot analysis was performed using TEAD1 Rabbit pAb (A6768) at 1:200 dilution.
ABclonal:Chromatin Immunoprecipitation - TEAD1 Rabbit pAb (A6768)}

Chromatin Immunoprecipitation - TEAD1 Rabbit pAb (A6768)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TEAD1 antibody (A6768) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Inquire About This Product

Submit your question about A6768 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TEAD1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TEAD1. (Distance between topics and target gene indicate popularity.) TEAD1

* Data provided by citexs.com, for reference only.

Publishing research using A6768? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order