Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Western blot analysis of various lysates using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Dot Blot - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Dot-blot analysis of all sorts of methylation peptides using Symmetric DiMethyl-Histone H3-R2 antibody (A2373).

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H3-R2 in paraffin-embedded rat liver using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H3-R2 in paraffin-embedded human stomach using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H3-R2 in paraffin-embedded mouse brain using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunofluorescence analysis of NIH/3T3 cells using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunofluorescence analysis of U2OS cells using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Symmetric DiMethyl-Histone H3-R2 Rabbit pAb
Catalog No. A2373
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID 82908350
Swiss prot Q16695P68431
Synonyms H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Symmetric DiMethyl-Histone H3-R2
Calculated MW 16kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • ChIP-seq 1:20 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa acid extract, NIH/3T3 acid extract, C6 acid extract, H3 protein
Cellular location Chromosome, Nucleus
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Symmetric DiMethyl-Histone H3-R2 Rabbit pAb images

ABclonal:Western blot - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)}

Western blot - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Western blot analysis of various lysates using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Dot Blot - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)}

Dot Blot - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Dot-blot analysis of all sorts of methylation peptides using Symmetric DiMethyl-Histone H3-R2 antibody (A2373).
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)}

Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H3-R2 in paraffin-embedded rat liver using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)}

Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H3-R2 in paraffin-embedded human stomach using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)}

Immunohistochemistry - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunohistochemistry analysis of Symmetric DiMethyl-Histone H3-R2 in paraffin-embedded mouse brain using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)}

Immunofluorescence - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunofluorescence analysis of NIH/3T3 cells using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)}

Immunofluorescence - Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373)

Immunofluorescence analysis of U2OS cells using Symmetric DiMethyl-Histone H3-R2 Rabbit pAb (A2373) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A2373 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H3-4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H3-4. (Distance between topics and target gene indicate popularity.) H3-4

* Data provided by citexs.com, for reference only.

Publishing research using A2373? Please let us know so that we can cite the reference in this datasheet.

Antibodies (114)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order