Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Slug Rabbit pAb (A1057)

Reviews (4) Publications (23) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Slug Rabbit pAb (A1057)

Western blot analysis of lysates from Mouse spleen, using Slug Rabbit pAb (A1057) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - Slug Rabbit pAb (A1057)

Western blot analysis of lysates from HeLa cells, using Slug Rabbit pAb (A1057) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Review
ABclonal: review for Slug Rabbit pAb(A1057)
Review
ABclonal: review for Slug Rabbit pAb(A1057)
Review
ABclonal: review for Slug Rabbit pAb(A1057)
Review
ABclonal: review for Slug Rabbit pAb(A1057)

You may also interested in:

Overview

Product name Slug Rabbit pAb
Catalog No. A1057
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Slug (NP_003059.1).
Sequence MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLH
Gene ID 6591
Swiss prot O43623
Synonyms SLUG; WS2D; SLUGH; SLUGH1; SNAIL2; Slug
Calculated MW 30kDa
Observed MW 30kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, Mouse spleen
Cellular location Cytoplasm, Nucleus
Customer validation

WB (mouse cells, MDA-MB-231, Mouse kidney cortexHomo sapiens, Homo sapiens, Mus musculus)

IF (Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Slug Rabbit pAb images

ABclonal:Western blot - Slug Rabbit pAb (A1057)}

Western blot - Slug Rabbit pAb (A1057)

Western blot analysis of lysates from Mouse spleen, using Slug Rabbit pAb (A1057) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - Slug Rabbit pAb (A1057)}

Western blot - Slug Rabbit pAb (A1057)

Western blot analysis of lysates from HeLa cells, using Slug Rabbit pAb (A1057) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Submit an review for A1057

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1057 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SNAI2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SNAI2. (Distance between topics and target gene indicate popularity.) SNAI2

* Data provided by citexs.com, for reference only.

Publishing research using A1057? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order