Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Snail Rabbit pAb (A11794)

Review (1) Publications (23) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Snail Rabbit pAb (A11794)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Snail using Snail Rabbit pAb (A11794) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - Snail Rabbit pAb (A11794)

Western blot analysis of various lysates using Snail Rabbit pAb (A11794) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 1s.

ABclonal:Western blot - Snail Rabbit pAb (A11794)

Western blot analysis of lysates from NIH/3T3 cells using Snail Rabbit pAb(A11794) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:15s.

ABclonal:Immunohistochemistry - Snail Rabbit pAb (A11794)

Immunohistochemistry analysis of Snail in paraffin-embedded rat spleen using Snail Rabbit pAb (A11794) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Snail Rabbit pAb (A11794)

Immunohistochemistry analysis of Snail in paraffin-embedded human esophageal cancer using Snail Rabbit pAb (A11794) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Snail Rabbit pAb (A11794)

Immunohistochemistry analysis of Snail in paraffin-embedded mouse lung using Snail Rabbit pAb (A11794) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Snail Rabbit pAb (A11794)

Immunofluorescence analysis of L929 cells using Snail Rabbit pAb (A11794) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Snail Rabbit pAb(A11794)

You may also interested in:

Overview

Product name Snail Rabbit pAb
Catalog No. A11794
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-267 of human Snail (NP_005976.2).
Sequence RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
Gene ID 6615
Swiss prot O95863
Synonyms SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1; Snail
Calculated MW 29kDa
Observed MW 35kDa/29kDa/35kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293F transfected with Snail, HeLa, HCT 116, K-562, NIH/3T3
Cellular location Cytoplasm, Nucleus
Customer validation

WB (mouse cellsMus musculus, Mus musculus, Homo sapiens, Rattus norvegicus)

IHC (Homo sapiens, Rattus norvegicus, Cervus nippon)

Mus musculus (IF)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Snail Rabbit pAb images

ABclonal:Western blot - Snail Rabbit pAb (A11794)}

Western blot - Snail Rabbit pAb (A11794)

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Snail using Snail Rabbit pAb (A11794) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - Snail Rabbit pAb (A11794)}

Western blot - Snail Rabbit pAb (A11794)

Western blot analysis of various lysates using Snail Rabbit pAb (A11794) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 1s.
ABclonal:Western blot - Snail Rabbit pAb (A11794)}

Western blot - Snail Rabbit pAb (A11794)

Western blot analysis of lysates from NIH/3T3 cells using Snail Rabbit pAb(A11794) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:15s.
ABclonal:Immunohistochemistry - Snail Rabbit pAb (A11794)}

Immunohistochemistry - Snail Rabbit pAb (A11794)

Immunohistochemistry analysis of Snail in paraffin-embedded rat spleen using Snail Rabbit pAb (A11794) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Snail Rabbit pAb (A11794)}

Immunohistochemistry - Snail Rabbit pAb (A11794)

Immunohistochemistry analysis of Snail in paraffin-embedded human esophageal cancer using Snail Rabbit pAb (A11794) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Snail Rabbit pAb (A11794)}

Immunohistochemistry - Snail Rabbit pAb (A11794)

Immunohistochemistry analysis of Snail in paraffin-embedded mouse lung using Snail Rabbit pAb (A11794) at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Snail Rabbit pAb (A11794)}

Immunofluorescence - Snail Rabbit pAb (A11794)

Immunofluorescence analysis of L929 cells using Snail Rabbit pAb (A11794) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A11794

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11794 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SNAI1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SNAI1. (Distance between topics and target gene indicate popularity.) SNAI1

* Data provided by citexs.com, for reference only.

Publishing research using A11794? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order