Review (1) Publications (23) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | Snail Rabbit pAb |
---|---|
Catalog No. | A11794 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-267 of human Snail (NP_005976.2). |
---|---|
Sequence | RTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR |
Gene ID | 6615 |
Swiss prot | O95863 |
Synonyms | SNA; SNAH; SNAIL; SLUGH2; SNAIL1; dJ710H13.1; Snail |
Calculated MW | 29kDa |
Observed MW | 35kDa/29kDa/35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293F transfected with Snail, HeLa, HCT 116, K-562, NIH/3T3 |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB (mouse cellsMus musculus, Mus musculus, Homo sapiens, Rattus norvegicus) IHC (Homo sapiens, Rattus norvegicus, Cervus nippon) Mus musculus (IF) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A11794 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on SNAI1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to SNAI1. (Distance between topics and target gene indicate popularity.) SNAI1
* Data provided by citexs.com, for reference only.
Publishing research using A11794? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.