Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SIRT1 Rabbit pAb (A11267)

Publications (41) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SIRT1 Rabbit pAb (A11267)

Western blot analysis of various lysates, using SIRT1 antibody (A11267) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - SIRT1 Rabbit pAb (A11267)

Immunohistochemistry analysis of paraffin-embedded human colon using SIRT1 Rabbit pAb (A11267) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name SIRT1 Rabbit pAb
Catalog No. A11267
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 448-747 of human SIRT1 (NP_036370.2).
Sequence VALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS
Gene ID 23411
Swiss prot Q96EB6
Synonyms SIR2; SIR2L1; SIR2alpha; SIRT1
Calculated MW 82kDa
Observed MW 120kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293F, HeLa
Cellular location Cytoplasm, Mitochondrion, Nucleus, Nucleus, PML body
Customer validation

WB (Sus scrofa, Danio rerio, Rattus norvegicus, Mus musculus, Homo sapiens, Gallus gallus, Carassius gibelio, Bos taurus)

IHC (Rattus norvegicus, Mus musculus)

IF (Rattus norvegicus, Cherax quadricarinatus, Homo sapiens, Mus musculus)

ELISA (Rattus norvegicus)

ChIP (Mus musculus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SIRT1 Rabbit pAb images

ABclonal:Western blot - SIRT1 Rabbit pAb (A11267)}

Western blot - SIRT1 Rabbit pAb (A11267)

Western blot analysis of various lysates, using SIRT1 antibody (A11267) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - SIRT1 Rabbit pAb (A11267)}

Immunohistochemistry - SIRT1 Rabbit pAb (A11267)

Immunohistochemistry analysis of paraffin-embedded human colon using SIRT1 Rabbit pAb (A11267) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A11267 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SIRT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SIRT1. (Distance between topics and target gene indicate popularity.) SIRT1

* Data provided by citexs.com, for reference only.

Publishing research using A11267? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order