Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

S100A12 Rabbit pAb (A5328)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - S100A12 Rabbit pAb (A5328)

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with S100A12 using S100A12 Rabbit pAb (A5328) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human colon carcinoma using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human esophageal cancer using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human esophagus using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human tonsil using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - S100A12 Rabbit pAb (A5328)

Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded human spleen using S100A12 Rabbit pAb (A5328) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name S100A12 Rabbit pAb
Catalog No. A5328
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100A12 (NP_005612.1).
Sequence MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Gene ID 6283
Swiss prot P80511
Synonyms p6; CAGC; CGRP; MRP6; CAAF1; MRP-6; ENRAGE; S100A12
Calculated MW 10kDa
Observed MW 11kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:100 - 1:500
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293F transfected with S100A12
Cellular location Cell membrane, Cytoplasm, Peripheral membrane protein, Secreted, cytoskeleton
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

S100A12 Rabbit pAb images

ABclonal:Western blot - S100A12 Rabbit pAb (A5328)}

Western blot - S100A12 Rabbit pAb (A5328)

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with S100A12 using S100A12 Rabbit pAb (A5328) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)}

Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human colon carcinoma using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)}

Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human esophageal cancer using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)}

Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human esophagus using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - S100A12 Rabbit pAb (A5328)}

Immunohistochemistry - S100A12 Rabbit pAb (A5328)

Immunohistochemistry analysis of S100A12 in paraffin-embedded human tonsil using S100A12 Rabbit pAb (A5328) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - S100A12 Rabbit pAb (A5328)}

Immunofluorescence - S100A12 Rabbit pAb (A5328)

Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded human spleen using S100A12 Rabbit pAb (A5328) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5328 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on S100A12. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to S100A12. (Distance between topics and target gene indicate popularity.) S100A12

* Data provided by citexs.com, for reference only.

Publishing research using A5328? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (2)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order