Product Type > Antibodies > Tag and Loading Control Antibodies

Rabbit anti GFP-Tag pAb (AE011)

Publications (60) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Species independent

ABclonal:Western blot - Rabbit anti GFP-Tag pAb (AE011)

Western blot analysis of extracts of normal 293T cells and 293T transfected with GFP-tagged fusion protein, using Rabbit anti GFP-Tag pAb (AE011) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - Rabbit anti GFP-Tag pAb (AE011)

Western blot analysis of extracts of normal Eukaryotic expression of GFP and Eukaryotic expression of GFP transfected with GFP Protein, using Rabbit anti GFP-Tag pAb (AE011) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - Rabbit anti GFP-Tag pAb (AE011)

Immunofluorescence analysis of 293T and 293T-GFP cells using Rabbit anti GFP-Tag pAb (AE011) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Rabbit anti GFP-Tag pAb
Catalog No. AE011
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The green fluorescent protein (GFP) is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to light in the blue to ultraviolet range. Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the jellyfish Aequorea victoria. The GFP from A. victoria has a major excitation peak at a wavelength of 395 nm and a minor one at 475 nm. Its emission peak is at 509 nm, which is in the lower green portion of the visible spectrum. The GFP from the sea pansy (Renilla reniformis) has a single major excitation peak at 498 nm. GFP makes for an excellent tool in many forms of biology due to its ability to form internal chromophore without requiring any accessory cofactors, gene products, or enzymes / substrates other than molecular oxygen.In cell and molecular biology, the GFP gene is frequently used as a reporter of expression. It has been used in modified forms to make biosensors, and many animals have been created that express GFP, which demonstrates a proof of concept that a gene can be expressed throughout a given organism, in selected organs, or in cells of interest. GFP can be introduced into animals or other species through transgenic techniques, and maintained in their genome and that of their offspring. To date, GFP has been expressed in many species, including bacteria, yeasts, fungi, fish and mammals, including in human cells.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-238 of GFP.
Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Gene ID
Swiss prot P42212
Synonyms GFP; GFP tag; GFP-tag
Calculated MW 27kDa
Observed MW 25kDa

Applications

Reactivity Species independent
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:2000 - 1:20000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, insect
Cellular location
Customer validation

WB (Arabidopsis thaliana, Homo sapiens, Mus musculus, Zea mays, lamprey, Nicotiana tabacum, Streptococcus pneumoniae, Glycine max, Solanum tuberosum, Cyprinus Carpio, Triticum aestivum, Yeast)

IF (Homo sapiens, Nicotiana tabacum, Oryza sativa, Mus musculus, Danio rerio)

IP (Homo sapiens, Drosophila melanogaster, Mus musculus, O. sativa L.)

Co-IP (Homo sapiens, Arabidopsis thaliana)

CO-IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Rabbit anti GFP-Tag pAb images

ABclonal:Western blot - Rabbit anti GFP-Tag pAb (AE011)}

Western blot - Rabbit anti GFP-Tag pAb (AE011)

Western blot analysis of extracts of normal 293T cells and 293T transfected with GFP-tagged fusion protein, using Rabbit anti GFP-Tag pAb (AE011) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - Rabbit anti GFP-Tag pAb (AE011)}

Western blot - Rabbit anti GFP-Tag pAb (AE011)

Western blot analysis of extracts of normal Eukaryotic expression of GFP and Eukaryotic expression of GFP transfected with GFP Protein, using Rabbit anti GFP-Tag pAb (AE011) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - Rabbit anti GFP-Tag pAb (AE011)}

Immunofluorescence - Rabbit anti GFP-Tag pAb (AE011)

Immunofluorescence analysis of 293T and 293T-GFP cells using Rabbit anti GFP-Tag pAb (AE011) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about AE011 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GFP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GFP. (Distance between topics and target gene indicate popularity.) GFP

* Data provided by citexs.com, for reference only.

Publishing research using AE011? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order