Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NF-kB p65/RelA Rabbit pAb (A11204)

Review (1) Publications (16) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A11204)

Western blot analysis of lysates from 293T cells, using NF-kB p65/RelA Rabbit pAb (A11204) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A11204)

Immunofluorescence analysis of U2OS cells using NF-kB p65/RelA Rabbit pAb (A11204) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - NF-kB p65/RelA Rabbit pAb (A11204)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg NF-kB p65/RelA antibody (A11204). Western blot was performed from the immunoprecipitate using NF-kB p65/RelA antibody (A11204) at a dilution of 1:1000.

Review
ABclonal: review for NF-kB p65/RelA Rabbit pAb(A11204)

You may also interested in:

Overview

Product name NF-kB p65/RelA Rabbit pAb
Catalog No. A11204
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (NP_068810.3).
Sequence LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Gene ID 5970
Swiss prot Q04206
Synonyms p65; CMCU; NFKB3; AIF3BL3; NF-kB p65/RelA
Calculated MW 60kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples 293T
Cellular location Cytoplasm, Nucleus
Customer validation

WB (C57BL6Homo sapiens, Mus musculus, Sus scrofa, Homo sapiens, Rattus norvegicus)

IF (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NF-kB p65/RelA Rabbit pAb images

ABclonal:Western blot - NF-kB p65/RelA Rabbit pAb (A11204)}

Western blot - NF-kB p65/RelA Rabbit pAb (A11204)

Western blot analysis of lysates from 293T cells, using NF-kB p65/RelA Rabbit pAb (A11204) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A11204)}

Immunofluorescence - NF-kB p65/RelA Rabbit pAb (A11204)

Immunofluorescence analysis of U2OS cells using NF-kB p65/RelA Rabbit pAb (A11204) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - NF-kB p65/RelA Rabbit pAb (A11204)}

Immunoprecipitation - NF-kB p65/RelA Rabbit pAb (A11204)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg NF-kB p65/RelA antibody (A11204). Western blot was performed from the immunoprecipitate using NF-kB p65/RelA antibody (A11204) at a dilution of 1:1000.

Submit an review for A11204

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A11204 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on RELA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to RELA. (Distance between topics and target gene indicate popularity.) RELA

* Data provided by citexs.com, for reference only.

Publishing research using A11204? Please let us know so that we can cite the reference in this datasheet.

Antibodies (22)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order