Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PPARγ Rabbit pAb (A0270)

Reviews (2) Publications (62) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunohistochemistry - PPARγ Rabbit pAb (A0270)

Immunohistochemistry analysis of PPARγ in paraffin-embedded mouse heart using PPARγ Rabbit pAb (A0270) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - PPARγ Rabbit pAb (A0270)

Immunohistochemistry analysis of PPARγ in paraffin-embedded mouse liver using PPARγ Rabbit pAb (A0270) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PPARγ Rabbit pAb (A0270)

Immunofluorescence analysis of U2OS cells using PPARγ Rabbit pAb (A0270) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for PPARγ Rabbit pAb(A0270)
Review
ABclonal: review for PPARγ Rabbit pAb(A0270)

You may also interested in:

Overview

Product name PPARγ Rabbit pAb
Catalog No. A0270
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PPARγ (NP_056953.2).
Sequence QEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLA
Gene ID 5468
Swiss prot P37231
Synonyms GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma; PPARγ
Calculated MW 58kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Immunohistochemistry    Immunofluorescence    
Positive samples Mouse liver, Mouse heart, Rat fat
Cellular location Cytoplasm, Nucleus
Customer validation

IHC (Mouse Embryonic Stem CellsMus musculus, Mus musculus, Rattus norvegicus, Homo sapiens)

WB (Human liver cellRattus norvegicus, Mesocricetus auratus, Sus scrofa, Homo sapiens, Mus musculus, Melodinus cochinchinensis, Gallus gallus, Rattus norvegicus, Oryctolagus cuniculus)

IF (Mus musculus, Rattus norvegicus, Homo sapiens)

qRT-PCR (Sus scrofa)

RT-PCR (Mus musculus)

IB (Homo sapiens)

RT-qPCR (Rattus norvegicus)

HE (Rattus norvegicus)

Co-IP (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PPARγ Rabbit pAb images

ABclonal:Immunohistochemistry - PPARγ Rabbit pAb (A0270)}

Immunohistochemistry - PPARγ Rabbit pAb (A0270)

Immunohistochemistry analysis of PPARγ in paraffin-embedded mouse heart using PPARγ Rabbit pAb (A0270) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - PPARγ Rabbit pAb (A0270)}

Immunohistochemistry - PPARγ Rabbit pAb (A0270)

Immunohistochemistry analysis of PPARγ in paraffin-embedded mouse liver using PPARγ Rabbit pAb (A0270) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - PPARγ Rabbit pAb (A0270)}

Immunofluorescence - PPARγ Rabbit pAb (A0270)

Immunofluorescence analysis of U2OS cells using PPARγ Rabbit pAb (A0270) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A0270

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0270 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPARG. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPARG. (Distance between topics and target gene indicate popularity.) PPARG

* Data provided by citexs.com, for reference only.

Publishing research using A0270? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order