Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

OCT4 Rabbit pAb (A7920)

Reviews (2) Publications (26) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - OCT4 Rabbit pAb (A7920)

Western blot analysis of Mouse embryo, using OCT4 antibody (A7920) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - OCT4 Rabbit pAb (A7920)

Immunohistochemistry analysis of paraffin-embedded mouse fetal Brain using OCT4 Rabbit pAb (A7920) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Review
ABclonal: review for OCT4 Rabbit pAb(A7920)
Review
ABclonal: review for OCT4 Rabbit pAb(A7920)

You may also interested in:

Overview

Product name OCT4 Rabbit pAb
Catalog No. A7920
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 210-310 of human 4-oct (NP_002692.2).
Sequence EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPV
Gene ID 5460
Swiss prot Q01860
Synonyms OCT3; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4; Oct3/4
Calculated MW 39kDa
Observed MW 45kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse embryo
Cellular location Cytoplasm, Nucleus
Customer validation

IHC (HeLa cellsMus musculus, Homo sapiens, Mus musculus)

IF (HeLa cellsHomo sapiens)

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

OCT4 Rabbit pAb images

ABclonal:Western blot - OCT4 Rabbit pAb (A7920)}

Western blot - OCT4 Rabbit pAb (A7920)

Western blot analysis of Mouse embryo, using OCT4 antibody (A7920) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
ABclonal:Immunohistochemistry - OCT4 Rabbit pAb (A7920)}

Immunohistochemistry - OCT4 Rabbit pAb (A7920)

Immunohistochemistry analysis of paraffin-embedded mouse fetal Brain using OCT4 Rabbit pAb (A7920) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Submit an review for A7920

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7920 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on POU5F1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to POU5F1. (Distance between topics and target gene indicate popularity.) POU5F1

* Data provided by citexs.com, for reference only.

Publishing research using A7920? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order