Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PLC gamma 1 (PLCG1) Rabbit pAb (A7711)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - PLC gamma 1 (PLCG1) Rabbit pAb (A7711)

Western blot analysis of extracts of various cell lines, using PLC gamma 1 (PLC gamma 1 (PLCG1)) antibody (A7711) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name PLC gamma 1 (PLCG1) Rabbit pAb
Catalog No. A7711
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene catalyzes the formation of inositol 1, 4, 5-trisphosphate and diacylglycerol from phosphatidylinositol 4, 5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 1 (PLCG1) (NP_002651.2).
Sequence NSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF
Gene ID 5335
Swiss prot P19174
Synonyms PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1; PLC gamma 1 (PLCG1)
Calculated MW 149kDa
Observed MW 160kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7, Jurkat, HepG2, Mouse brain, Mouse lung, Rat brain
Cellular location Cell projection, lamellipodium, ruffle
Customer validation

WB (Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PLC gamma 1 (PLCG1) Rabbit pAb images

ABclonal:Western blot - PLC gamma 1 (PLCG1) Rabbit pAb (A7711)}

Western blot - PLC gamma 1 (PLCG1) Rabbit pAb (A7711)

Western blot analysis of extracts of various cell lines, using PLC gamma 1 (PLC gamma 1 (PLCG1)) antibody (A7711) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A7711 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PLCG1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PLCG1. (Distance between topics and target gene indicate popularity.) PLCG1

* Data provided by citexs.com, for reference only.

Publishing research using A7711? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order