Publications (2) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | PLC gamma 1 (PLCG1) Rabbit pAb |
---|---|
Catalog No. | A7711 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 1 (PLCG1) (NP_002651.2). |
---|---|
Sequence | NSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF |
Gene ID | 5335 |
Swiss prot | P19174 |
Synonyms | PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1; PLC gamma 1 (PLCG1) |
Calculated MW | 149kDa |
Observed MW | 160kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | MCF7, Jurkat, HepG2, Mouse brain, Mouse lung, Rat brain |
Cellular location | Cell projection, lamellipodium, ruffle |
Customer validation | WB (Homo sapiens) IHC (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A7711 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on PLCG1. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to PLCG1. (Distance between topics and target gene indicate popularity.) PLCG1
* Data provided by citexs.com, for reference only.
Publishing research using A7711? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.