Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD31/PECAM1 Rabbit pAb (A3181)

Reviews (2) Publications (11) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD31/PECAM1 Rabbit pAb (A3181)

Western blot analysis of lysates from U-937 cells, using CD31/PECAM1 Rabbit pAb (A3181) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Review
ABclonal: review for CD31/PECAM1 Rabbit pAb(A3181)
Review
ABclonal: review for CD31/PECAM1 Rabbit pAb(A3181)

You may also interested in:

Overview

Product name CD31/PECAM1 Rabbit pAb
Catalog No. A3181
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable protein homodimerization activity; protein phosphatase binding activity; and transmembrane signaling receptor activity. Acts upstream of or within several processes, including Rho protein signal transduction; endothelial cell morphogenesis; and positive regulation of tyrosine phosphorylation of STAT protein. Located in several cellular components, including cell-cell contact zone; external side of plasma membrane; and smooth muscle contractile fiber. Is expressed in several structures, including alimentary system; cardiovascular system; central nervous system; extraembryonic component; and genitourinary system. Human ortholog(s) of this gene implicated in coronary artery disease (multiple); lung non-small cell carcinoma; neuroblastoma; and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-738 of CD31/PECAM1 (NP_000433.4).
Sequence AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Gene ID 18613
Swiss prot Q08481
Synonyms Cd31; Pecam; PECAM-1; CD31/PECAM1
Calculated MW 81kDa
Observed MW 130kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-937
Cellular location Cell junction, Cell junction, Cell membrane, Lipid-anchor, Single-pass type I membrane protein
Customer validation

IF (Rat lung)

IHC (Human prostateMus musculus, Rattus norvegicus, Homo sapiens, Mus musculus)

WB (Homo sapiens, Mus musculus, Rattus norvegicus)

ICC (Rattus norvegicus, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CD31/PECAM1 Rabbit pAb images

ABclonal:Western blot - CD31/PECAM1 Rabbit pAb (A3181)}

Western blot - CD31/PECAM1 Rabbit pAb (A3181)

Western blot analysis of lysates from U-937 cells, using CD31/PECAM1 Rabbit pAb (A3181) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Submit an review for A3181

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A3181 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Pecam1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Pecam1. (Distance between topics and target gene indicate popularity.) Pecam1

* Data provided by citexs.com, for reference only.

Publishing research using A3181? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order