Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

iNOS Rabbit pAb (A3200)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - iNOS Rabbit pAb (A3200)

Western blot analysis of extracts of RAW264.7 cells, using iNOS antibody (A3200) at 1:1000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for over night.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - iNOS Rabbit pAb (A3200)

Western blot analysis of extracts of RAW264.7 cells, using iNOS antibody (A3200) at 1:1000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name iNOS Rabbit pAb
Catalog No. A3200
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human iNOS (NP_000616.3).
Sequence MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVT
Gene ID 4843
Swiss prot P35228
Synonyms NOS; INOS; NOS2A; HEP-NOS; iNOS
Calculated MW 131kDa
Observed MW 131kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples RAW264.7
Cellular location cortical cytoskeleton, cytoplasm, cytosol, nucleoplasm, nucleus, perinuclear region of cytoplasm, peroxisomal matrix, peroxisome, plasma membrane
Customer validation

IHC (Homo sapiens)

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

iNOS Rabbit pAb images

ABclonal:Western blot - iNOS Rabbit pAb (A3200)}

Western blot - iNOS Rabbit pAb (A3200)

Western blot analysis of extracts of RAW264.7 cells, using iNOS antibody (A3200) at 1:1000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for over night.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - iNOS Rabbit pAb (A3200)}

Western blot - iNOS Rabbit pAb (A3200)

Western blot analysis of extracts of RAW264.7 cells, using iNOS antibody (A3200) at 1:1000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A3200 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NOS2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NOS2. (Distance between topics and target gene indicate popularity.) NOS2

* Data provided by citexs.com, for reference only.

Publishing research using A3200? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order