Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

NEDD4 Rabbit pAb (A0552)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - NEDD4 Rabbit pAb (A0552)

Western blot analysis of extracts of various cell lines, using NEDD4 antibody (A0552) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - NEDD4 Rabbit pAb (A0552)

Immunohistochemistry analysis of paraffin-embedded human prostate using NEDD4 antibody (A0552) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - NEDD4 Rabbit pAb (A0552)

Immunohistochemistry analysis of paraffin-embedded human gastric using NEDD4 antibody (A0552) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name NEDD4 Rabbit pAb
Catalog No. A0552
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 160-460 of human NEDD4 (NP_940682.2).
Sequence GSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFIISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNTPRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTSACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLG
Gene ID 4734
Swiss prot P46934
Synonyms RPF1; NEDD4-1; NEDD4
Calculated MW 149kDa
Observed MW 120kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-251MG, HeLa, Jurkat, A-549, SKOV3
Cellular location Cell membrane, Cytoplasm, Peripheral membrane protein
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NEDD4 Rabbit pAb images

ABclonal:Western blot - NEDD4 Rabbit pAb (A0552)}

Western blot - NEDD4 Rabbit pAb (A0552)

Western blot analysis of extracts of various cell lines, using NEDD4 antibody (A0552) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
ABclonal:Immunohistochemistry - NEDD4 Rabbit pAb (A0552)}

Immunohistochemistry - NEDD4 Rabbit pAb (A0552)

Immunohistochemistry analysis of paraffin-embedded human prostate using NEDD4 antibody (A0552) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - NEDD4 Rabbit pAb (A0552)}

Immunohistochemistry - NEDD4 Rabbit pAb (A0552)

Immunohistochemistry analysis of paraffin-embedded human gastric using NEDD4 antibody (A0552) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A0552 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NEDD4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NEDD4. (Distance between topics and target gene indicate popularity.) NEDD4

* Data provided by citexs.com, for reference only.

Publishing research using A0552? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order