Product Type > Antibodies > Tag and Loading Control Antibodies

Mouse anti GST-Tag mAb (AE001)

Publications (76) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Species independent

ABclonal:Western blot - Mouse anti GST-Tag mAb (AE001)

Western blot analysis of over-expressed GST protein using Mouse anti GST-Tag mAb (AE001) at different dilution. Each lane was loaded with 2 ug cell lysate.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - Mouse anti GST-Tag mAb (AE001)

Immunoprecipitation analysis of 1 μg extracts of GST-Tag cells using 3 μg Mouse anti GST-Tag mAb antibody (AE001). Western blot was performed from the immunoprecipitate using Mouse anti GST-Tag mAb antibody (AE001) at a dilution of 1:1000.

You may also interested in:

Overview

Product name Mouse anti GST-Tag mAb
Catalog No. AE001
Host species Mouse
Purification method Affinity purification
Isotype IgG1
CloneNo. AMC0501

Background

Glutathione S-transferases (GSTs), previously known as ligandins, comprise a family of eukaryotic and prokaryotic phase II metabolic isozymes best known for their ability to catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for the purpose of detoxification. The GST family consists of three superfamilies: the cytosolic, mitochondrial, and microsomal—also known as MAPEG—proteins. Members of the GST superfamily are extremely diverse in amino acid sequence, and a large fraction of the sequences deposited in public databases are of unknown function. The Enzyme Function Initiative (EFI) is using GSTs as a model superfamily to identify new GST functions.A GST-tag is often used to separate and purify proteins that contain the GST-fusion protein. The tag is 220 amino acids (roughly 26 KDa) in size, which, compared to tags such as the Myc-tag or the FLAG-tag, is quite large. It can be fused to either the N-terminus or C-terminus of a protein. However, many commercially available sources of GST-tagged plasmids include a thrombin domain for cleavage of the GST tag during protein purification.

Immunogen information

Immunogen Recombinant protein containing a sequence corresponding to amino acids 1-218 of GST protein.
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Gene ID
Swiss prot
Synonyms GST; GST tag; GST-tag
Calculated MW 26kDa
Observed MW 27kDa

Applications

Reactivity Species independent
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:2000 - 1:5000
  • IP 3μg antibody for 1μg extracts of recombinant protein
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 1.5% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples GST-Tag
Cellular location
Customer validation

WB (Homo sapiens, Oryza sativa, Gallus gallus, Yeast, Other, Arabidopsis thaliana, Nicotiana benthamiana, grass carp, Mus musculus, Botrytis cinerea, Caenorhabditis elegans, Escherichia coli, Sus scrofa, Oryza sativa L, Malus pumila, Malus domestica, Ctenopharyngodon idellus, Glycine max, Chlorocebus aethiops, Zea mays)

ELISA (Mus musculus, Rattus norvegicus, Oyster)

IF (Mus musculus, Rattus norvegicus, Oyster)

Co-IP (Other, Ctenopharyngodon idellus, B. napus)

IP (Other, Mus musculus, Oryza sativa, Helicoverpa armigera, Escherichia coli, Ctenopharyngodon idellus, Arabidopsis thaliana, O. sativa L., Homo sapiens, Chlorocebus aethiops)

Protein pulldown (Arabidopsis thaliana)

ELISA assay (Homo sapiens)

EMSA (Arabidopsis thaliana)

Pull-down assay (Oryza sativa)

pull-down (Oryza sativa L., Arabidopsis)

WB IF IP (Homo sapiens)

Glutathione-S-transferase pull-down (Gossypium spp)

ChIP (Glycine max)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Mouse anti GST-Tag mAb images

ABclonal:Western blot - Mouse anti GST-Tag mAb (AE001)}

Western blot - Mouse anti GST-Tag mAb (AE001)

Western blot analysis of over-expressed GST protein using Mouse anti GST-Tag mAb (AE001) at different dilution. Each lane was loaded with 2 ug cell lysate.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunoprecipitation - Mouse anti GST-Tag mAb (AE001)}

Immunoprecipitation - Mouse anti GST-Tag mAb (AE001)

Immunoprecipitation analysis of 1 μg extracts of GST-Tag cells using 3 μg Mouse anti GST-Tag mAb antibody (AE001). Western blot was performed from the immunoprecipitate using Mouse anti GST-Tag mAb antibody (AE001) at a dilution of 1:1000.

Inquire About This Product

Submit your question about AE001 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GST. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GST. (Distance between topics and target gene indicate popularity.) GST

* Data provided by citexs.com, for reference only.

Publishing research using AE001? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order