Publications (10) Datasheet SDS
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human
Product name | Ki67 Rabbit mAb |
---|---|
Catalog No. | A11005 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0186 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ki67 (P46013). |
---|---|
Sequence | GKITKMPCQSLQPEPINTPTHTKQQLKASLGKVGVKEELLAVGKFTRTSGETTHTHREPAGDGKSIRTFKESPKQILDPAARVTGMKKWPRTPKEEAQSLE |
Gene ID | 4288 |
Swiss prot | P46013 |
Synonyms | KIA; MIB-; MIB-1; PPP1R105; Ki67 |
Calculated MW | 359kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | |
Cellular location | Chromosome, Nucleus, nucleolus |
Customer validation | WB (Mus musculus, Homo sapiens) IHC (Mus musculus, Homo sapiens) IF (Homo sapiens) |
Submit your question about A11005 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on MKI67. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to MKI67. (Distance between topics and target gene indicate popularity.) MKI67
* Data provided by citexs.com, for reference only.
Publishing research using A11005? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.
!OUT OF STOCK
See Below for Alternatives