Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Ki67 Rabbit mAb (A11005)

Publications (10) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

You may also interested in:

Overview

Product name Ki67 Rabbit mAb
Catalog No. A11005
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0186

Background

Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Ki67 (P46013).
Sequence GKITKMPCQSLQPEPINTPTHTKQQLKASLGKVGVKEELLAVGKFTRTSGETTHTHREPAGDGKSIRTFKESPKQILDPAARVTGMKKWPRTPKEEAQSLE
Gene ID 4288
Swiss prot P46013
Synonyms KIA; MIB-; MIB-1; PPP1R105; Ki67
Calculated MW 359kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location Chromosome, Nucleus, nucleolus
Customer validation

WB (Mus musculus, Homo sapiens)

IHC (Mus musculus, Homo sapiens)

IF (Homo sapiens)

Research Area

Inquire About This Product

Submit your question about A11005 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MKI67. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MKI67. (Distance between topics and target gene indicate popularity.) MKI67

* Data provided by citexs.com, for reference only.

Publishing research using A11005? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order