Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Lysozyme (LYZ) Rabbit mAb (A10972)

Reviews (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Lysozyme (LYZ) Rabbit mAb (A10972)

Western blot analysis of various lysates, using Lysozyme (LYZ) Rabbit mAb (A10972) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded mouse spleen tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded human spleen tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded human colon tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded human tonsil tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunofluorescence analysis of paraffin-embedded Human stomach using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:400 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Lysozyme (LYZ) Rabbit mAb(A10972)
Review
ABclonal: review for Lysozyme (LYZ) Rabbit mAb(A10972)

You may also interested in:

Overview

Product name Lysozyme (LYZ) Rabbit mAb
Catalog No. A10972
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC57153

Background

This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (NP_000230.1).
Sequence MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Gene ID 4069
Swiss prot P61626
Synonyms LZM; LYZF1; Lysozyme (LYZ)
Calculated MW 17kDa
Observed MW 15kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • WB 1:3000 - 1:20000
  • IHC-P 1:1000 - 1:5000
  • IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples U-937, RAW 264.7, Mouse lung, Rat lung
Cellular location Secreted
Customer validation

(Kidney, spleen)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Lysozyme (LYZ) Rabbit mAb images

ABclonal:Western blot - Lysozyme (LYZ) Rabbit mAb (A10972)}

Western blot - Lysozyme (LYZ) Rabbit mAb (A10972)

Western blot analysis of various lysates, using Lysozyme (LYZ) Rabbit mAb (A10972) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)}

Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded mouse spleen tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)}

Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded human spleen tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)}

Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded human colon tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)}

Immunohistochemistry - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunohistochemistry analysis of Lysozyme (LYZ) in paraffin-embedded human tonsil tissue using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - Lysozyme (LYZ) Rabbit mAb (A10972)}

Immunofluorescence - Lysozyme (LYZ) Rabbit mAb (A10972)

Immunofluorescence analysis of paraffin-embedded Human stomach using Lysozyme (LYZ) Rabbit mAb (A10972) at a dilution of 1:400 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A10972

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A10972 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LYZ. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LYZ. (Distance between topics and target gene indicate popularity.) LYZ

* Data provided by citexs.com, for reference only.

Publishing research using A10972? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order