Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LIN28A Rabbit pAb (A6034)

Reviews (2) Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - LIN28A Rabbit pAb (A6034)

Western blot analysis of lysates from T47D cells, using LIN28A Rabbit pAb (A6034) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - LIN28A Rabbit pAb (A6034)

Immunohistochemistry analysis of LIN28A in paraffin-embedded Human testicular seminoma using NY-ESO-1 Rabbit pAb (A6034) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Review
ABclonal: review for LIN28A Rabbit pAb(A6034)
Review
ABclonal: review for LIN28A Rabbit pAb(A6034)

You may also interested in:

Overview

Product name LIN28A Rabbit pAb
Catalog No. A6034
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-209 of human LIN28A (NP_078950.1).
Sequence SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Gene ID 79727
Swiss prot Q9H9Z2
Synonyms CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; LIN28A
Calculated MW 23kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples T47D
Cellular location Cytoplasm, Nucleus, nucleolus
Customer validation

WB (P19)

IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LIN28A Rabbit pAb images

ABclonal:Western blot - LIN28A Rabbit pAb (A6034)}

Western blot - LIN28A Rabbit pAb (A6034)

Western blot analysis of lysates from T47D cells, using LIN28A Rabbit pAb (A6034) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - LIN28A Rabbit pAb (A6034)}

Immunohistochemistry - LIN28A Rabbit pAb (A6034)

Immunohistochemistry analysis of LIN28A in paraffin-embedded Human testicular seminoma using NY-ESO-1 Rabbit pAb (A6034) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Submit an review for A6034

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6034 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on LIN28A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to LIN28A. (Distance between topics and target gene indicate popularity.) LIN28A

* Data provided by citexs.com, for reference only.

Publishing research using A6034? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order