Reviews (2) Publication (1) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | LIN28A Rabbit pAb |
---|---|
Catalog No. | A6034 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-209 of human LIN28A (NP_078950.1). |
---|---|
Sequence | SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN |
Gene ID | 79727 |
Swiss prot | Q9H9Z2 |
Synonyms | CSDD1; LIN28; LIN-28; ZCCHC1; lin-28A; LIN28A |
Calculated MW | 23kDa |
Observed MW | 28kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | T47D |
Cellular location | Cytoplasm, Nucleus, nucleolus |
Customer validation | WB (P19) IP (Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A6034 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on LIN28A. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to LIN28A. (Distance between topics and target gene indicate popularity.) LIN28A
* Data provided by citexs.com, for reference only.
Publishing research using A6034? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.