Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cytokeratin 20 (KRT20) Rabbit pAb (A0248)

Reviews (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Immunofluorescence - Cytokeratin 20 (KRT20) Rabbit pAb (A0248)

Confocal immunofluorescence analysis of A-431 cells using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (A0248) at dilution of 1:200. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Cytokeratin 20 (KRT20) Rabbit pAb(A0248)
Review
ABclonal: review for Cytokeratin 20 (KRT20) Rabbit pAb(A0248)

You may also interested in:

Overview

Product name Cytokeratin 20 (KRT20) Rabbit pAb
Catalog No. A0248
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 245-424 of human Cytokeratin 20 (Cytokeratin 20 (KRT20)) (NP_061883.1).
Sequence KYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
Gene ID 54474
Swiss prot P35900
Synonyms K20; CD20; CK20; CK-20; KRT21; Cytokeratin 20 (KRT20)
Calculated MW 48kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, Mouse intestine
Cellular location Cytoplasm
Customer validation

IF (Mouse colon)

IHC (Mouse colon)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 20 (KRT20) Rabbit pAb images

ABclonal:Immunofluorescence - Cytokeratin 20 (KRT20) Rabbit pAb (A0248)}

Immunofluorescence - Cytokeratin 20 (KRT20) Rabbit pAb (A0248)

Confocal immunofluorescence analysis of A-431 cells using Cytokeratin 20 (Cytokeratin 20 (KRT20)) antibody (A0248) at dilution of 1:200. Blue: DAPI for nuclear staining.

Submit an review for A0248

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0248 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KRT20. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KRT20. (Distance between topics and target gene indicate popularity.) KRT20

* Data provided by citexs.com, for reference only.

Publishing research using A0248? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order