Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

SQSTM1/p62 Rabbit mAb (A19700)

Reviews (2) Publications (80) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of various lysates using SQSTM1/p62 Rabbit mAb (A19700) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of lysates from PC-12 cells, using SQSTM1/p62 Rabbit mAb (A19700) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of lysates from HeLa cells, using SQSTM1/p62 Rabbit mAb (A19700) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human colon carcinoma tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded Human lung adenocarcinoma tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human liver cancer tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human cervix cancer tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human small intestine tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - SQSTM1/p62 Rabbit mAb (A19700)

Confocal imaging of HeLa cells using SQSTM1/p62 Rabbit mAb (A19700, dilution 1:200) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.

ABclonal:Immunoprecipitation - SQSTM1/p62 Rabbit mAb (A19700)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg SQSTM1/p62 Rabbit mAb (A19700). Western blot was performed from the immunoprecipitate using [KO Validated] SQSTM1/p62 Rabbit mAb (A19700) at a dilition of 1:1000.

Review
ABclonal: review for SQSTM1/p62 Rabbit mAb(A19700)
Review
ABclonal: review for SQSTM1/p62 Rabbit mAb(A19700)

You may also interested in:

Overview

Product name SQSTM1/p62 Rabbit mAb
Catalog No. A19700
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0180

Background

This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (Q13501).
Sequence LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Gene ID 8878
Swiss prot Q13501
Synonyms p60; p62; A170; DMRV; OSIL; PDB3; ZIP3; p62B; NADGP; FTDALS3; SQSTM1/p62
Calculated MW 48kDa
Observed MW 62kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
IHC-P HumanRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, HeLa, L929, C2C12, PC-12
Cellular location Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Late endosome, Lysosome, Nucleus, P-body, autophagosome
Customer validation

(mouse primary hepatocytes, HeLa、PC-3、U2-OS、293T)

WB (Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa, Gallus gallus, Anatinae)

IHC (Mus musculus)

IF (Gallus gallus, Sus scrofa, Homo sapiens, Mus musculus)

IP (Mus musculus)

IFWB (Mus musculus;Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SQSTM1/p62 Rabbit mAb images

ABclonal:Western blot - SQSTM1/p62 Rabbit mAb (A19700)}

Western blot - SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of various lysates using SQSTM1/p62 Rabbit mAb (A19700) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - SQSTM1/p62 Rabbit mAb (A19700)}

Western blot - SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of lysates from PC-12 cells, using SQSTM1/p62 Rabbit mAb (A19700) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - SQSTM1/p62 Rabbit mAb (A19700)}

Western blot - SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of lysates from HeLa cells, using SQSTM1/p62 Rabbit mAb (A19700) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human colon carcinoma tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded Human lung adenocarcinoma tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human liver cancer tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human cervix cancer tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry - SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry analysis of SQSTM1/p62 in paraffin-embedded human small intestine tissue using SQSTM1/p62 Rabbit mAb (A19700) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - SQSTM1/p62 Rabbit mAb (A19700)}

Immunofluorescence - SQSTM1/p62 Rabbit mAb (A19700)

Confocal imaging of HeLa cells using SQSTM1/p62 Rabbit mAb (A19700, dilution 1:200) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC049, dilution 1:100) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.
ABclonal:Immunoprecipitation - SQSTM1/p62 Rabbit mAb (A19700)}

Immunoprecipitation - SQSTM1/p62 Rabbit mAb (A19700)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg SQSTM1/p62 Rabbit mAb (A19700). Western blot was performed from the immunoprecipitate using [KO Validated] SQSTM1/p62 Rabbit mAb (A19700) at a dilition of 1:1000.

Submit an review for A19700

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A19700 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SQSTM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SQSTM1. (Distance between topics and target gene indicate popularity.) SQSTM1

* Data provided by citexs.com, for reference only.

Publishing research using A19700? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order