Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

LKB1 Rabbit pAb (A2122)

Reviews (2) Publications (15) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - LKB1 Rabbit pAb (A2122)

Western blot analysis of various lysates, using LKB1 antibody (A2122) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - LKB1 Rabbit pAb (A2122)

Western blot analysis of Mouse heart, using LKB1 antibody (A2122) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - LKB1 Rabbit pAb (A2122)

Western blot analysis of various lysates, using [KO Validated] LKB1 Rabbit pAb (A2122) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - LKB1 Rabbit pAb (A2122)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - LKB1 Rabbit pAb (A2122)

Immunofluorescence analysis of NIH/3T3 cells using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - LKB1 Rabbit pAb (A2122)

Immunofluorescence analysis of PC-12 cells using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - LKB1 Rabbit pAb (A2122)

Immunofluorescence analysis of U2OS cells using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for LKB1 Rabbit pAb(A2122)
Review
ABclonal: review for LKB1 Rabbit pAb(A2122)

You may also interested in:

Overview

Product name LKB1 Rabbit pAb
Catalog No. A2122
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a serine/threonine kinase that regulates cell polarity and energy metabolism and functions as a tumor suppressor. Mutations in this gene have been associated with the autosomal dominant Peutz-Jeghers syndrome, as well as with skin, pancreatic, and testicular cancers.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 134-433 of human LKB1 (NP_000446.1).
Sequence CGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ
Gene ID 6794
Swiss prot Q15831
Synonyms PJS; LKB1; hLKB1
Calculated MW 49kDa
Observed MW 49-60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples MCF7, 293T, Mouse heart, Rat heart
Cellular location Cytoplasm, Membrane, Mitochondrion, Nucleus
Customer validation

WB (HeLa, Human,Mouse,RatHomo sapiens, Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa, Capra hircus)

IF (Mus musculus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

LKB1 Rabbit pAb images

ABclonal:Western blot - LKB1 Rabbit pAb (A2122)}

Western blot - LKB1 Rabbit pAb (A2122)

Western blot analysis of various lysates, using LKB1 antibody (A2122) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - LKB1 Rabbit pAb (A2122)}

Western blot - LKB1 Rabbit pAb (A2122)

Western blot analysis of Mouse heart, using LKB1 antibody (A2122) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - LKB1 Rabbit pAb (A2122)}

Western blot - LKB1 Rabbit pAb (A2122)

Western blot analysis of various lysates, using [KO Validated] LKB1 Rabbit pAb (A2122) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - LKB1 Rabbit pAb (A2122)}

Immunohistochemistry - LKB1 Rabbit pAb (A2122)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - LKB1 Rabbit pAb (A2122)}

Immunofluorescence - LKB1 Rabbit pAb (A2122)

Immunofluorescence analysis of NIH/3T3 cells using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - LKB1 Rabbit pAb (A2122)}

Immunofluorescence - LKB1 Rabbit pAb (A2122)

Immunofluorescence analysis of PC-12 cells using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - LKB1 Rabbit pAb (A2122)}

Immunofluorescence - LKB1 Rabbit pAb (A2122)

Immunofluorescence analysis of U2OS cells using LKB1 Rabbit pAb (A2122) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A2122

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2122 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on STK11. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to STK11. (Distance between topics and target gene indicate popularity.) STK11

* Data provided by citexs.com, for reference only.

Publishing research using A2122? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order