Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CREB Rabbit mAb (A10826)

Publications (13) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - CREB Rabbit mAb (A10826)

Western blot analysis of extracts of various cell lines, using CREB1 antibody (A10826) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name CREB Rabbit mAb
Catalog No. A10826
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0113

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CREB1 (P16220).
Sequence ATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
Gene ID 1385
Swiss prot P16220
Synonyms CREB; CREB-1
Calculated MW 35kDa
Observed MW 43kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse lung, Mouse brain, Rat brain
Cellular location Nucleus
Customer validation

IF (Mus musculus, Homo sapiens)

WB (Rattus norvegicus, Homo sapiens, Mus musculus)

IHC (Homo sapiens)

IP (Homo sapiens, Mus musculus)

Research Area

CREB Rabbit mAb images

ABclonal:Western blot - CREB Rabbit mAb (A10826)}

Western blot - CREB Rabbit mAb (A10826)

Western blot analysis of extracts of various cell lines, using CREB1 antibody (A10826) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A10826 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CREB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CREB1. (Distance between topics and target gene indicate popularity.) CREB1

* Data provided by citexs.com, for reference only.

Publishing research using A10826? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order