Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KHDRBS1/Sam68 Rabbit pAb (A6101)

Reviews (2) Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KHDRBS1/Sam68 Rabbit pAb (A6101)

Western blot analysis of extracts of various cell lines, using KHDRBS1/Sam68 antibody (A6101) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded rat brain using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded human prostate cancer using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded human stomach using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded mouse liver using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - KHDRBS1/Sam68 Rabbit pAb (A6101)

Confocal immunofluorescence analysis of HeLa cells using KHDRBS1/Sam68 Polyclonal Antibody (A6101) at dilution of 1:400. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - KHDRBS1/Sam68 Rabbit pAb (A6101)

Confocal immunofluorescence analysis of U2OS cells using KHDRBS1/Sam68 Polyclonal Antibody (A6101) at dilution of 1:400. Blue: DAPI for nuclear staining.

Review
ABclonal: review for KHDRBS1/Sam68 Rabbit pAb(A6101)
Review
ABclonal: review for KHDRBS1/Sam68 Rabbit pAb(A6101)

You may also interested in:

Overview

Product name KHDRBS1/Sam68 Rabbit pAb
Catalog No. A6101
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 343-443 of human KHDRBS1/Sam68 (NP_006550.1).
Sequence PAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY
Gene ID 10657
Swiss prot Q07666
Synonyms p62; p68; Sam68; KHDRBS1/Sam68
Calculated MW 48kDa
Observed MW 68kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SKOV3, HeLa, Jurkat, PC-12, Mouse brain, Rat brain
Cellular location Membrane, Nucleus
Customer validation

IF (Zebrafish retina)

WB (Mus musculus, Homo sapiens)

IHC (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KHDRBS1/Sam68 Rabbit pAb images

ABclonal:Western blot - KHDRBS1/Sam68 Rabbit pAb (A6101)}

Western blot - KHDRBS1/Sam68 Rabbit pAb (A6101)

Western blot analysis of extracts of various cell lines, using KHDRBS1/Sam68 antibody (A6101) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)}

Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded rat brain using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)}

Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded human prostate cancer using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)}

Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded human stomach using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)}

Immunohistochemistry - KHDRBS1/Sam68 Rabbit pAb (A6101)

Immunohistochemistry analysis of paraffin-embedded mouse liver using KHDRBS1/Sam68 antibody (A6101) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - KHDRBS1/Sam68 Rabbit pAb (A6101)}

Immunofluorescence - KHDRBS1/Sam68 Rabbit pAb (A6101)

Confocal immunofluorescence analysis of HeLa cells using KHDRBS1/Sam68 Polyclonal Antibody (A6101) at dilution of 1:400. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - KHDRBS1/Sam68 Rabbit pAb (A6101)}

Immunofluorescence - KHDRBS1/Sam68 Rabbit pAb (A6101)

Confocal immunofluorescence analysis of U2OS cells using KHDRBS1/Sam68 Polyclonal Antibody (A6101) at dilution of 1:400. Blue: DAPI for nuclear staining.

Submit an review for A6101

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6101 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KHDRBS1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KHDRBS1. (Distance between topics and target gene indicate popularity.) KHDRBS1

* Data provided by citexs.com, for reference only.

Publishing research using A6101? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order