Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

VEGF Receptor 2 Rabbit pAb (A5609)

Reviews (3) Publications (18) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - VEGF Receptor 2 Rabbit pAb (A5609)

Western blot analysis of lysates from Mouse heart, using VEGF Receptor 2 Rabbit pAb (A5609) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Review
ABclonal: review for VEGF Receptor 2 Rabbit pAb(A5609)
Review
ABclonal: review for VEGF Receptor 2 Rabbit pAb(A5609)
Review
ABclonal: review for VEGF Receptor 2 Rabbit pAb(A5609)

You may also interested in:

Overview

Product name VEGF Receptor 2 Rabbit pAb
Catalog No. A5609
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1150-1250 of human VEGF Receptor 2 (NP_002244.1).
Sequence RPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVK
Gene ID 3791
Swiss prot P35968
Synonyms FLK1; CD309; VEGFR; VEGFR2; VEGF Receptor 2
Calculated MW 152kDa
Observed MW 210kDa/230kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse heart
Cellular location Cell junction, Cell membrane, Cytoplasm, Cytoplasmic vesicle, Early endosome, Endoplasmic reticulum, Nucleus, Secreted, Single-pass type I membrane protein
Customer validation

IHC (Eoma cellHomo sapiens)

WB (Eoma cell, HUVEC cellsHomo sapiens, Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus)

IF (Mus musculus, Gallus gallus, Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

VEGF Receptor 2 Rabbit pAb images

ABclonal:Western blot - VEGF Receptor 2 Rabbit pAb (A5609)}

Western blot - VEGF Receptor 2 Rabbit pAb (A5609)

Western blot analysis of lysates from Mouse heart, using VEGF Receptor 2 Rabbit pAb (A5609) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Submit an review for A5609

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5609 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KDR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KDR. (Distance between topics and target gene indicate popularity.) KDR

* Data provided by citexs.com, for reference only.

Publishing research using A5609? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Alternative Products
Contact us to order